DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and LOC306079

DIOPT Version :9

Sequence 1:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001041344.1 Gene:LOC306079 / 306079 RGDID:1564564 Length:354 Species:Rattus norvegicus


Alignment Length:43 Identity:11/43 - (25%)
Similarity:18/43 - (41%) Gaps:7/43 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAG 45
            :.|:..::..:..|.:||:...||...|.       ..|||.|
  Rat   146 RFMEVDRVAYISFGPHAGKLVAIVDVIDQ-------NRALVDG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_001262966.1 KOW 1..135 CDD:412330 11/43 (26%)
LOC306079NP_001041344.1 PTZ00065 146..269 CDD:240252 11/43 (26%)
KOW_RPL14 149..222 CDD:240512 10/40 (25%)
Ribosomal_L14e 188..261 CDD:280163
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.