powered by:
Protein Alignment RpL27 and LOC306079
DIOPT Version :9
Sequence 1: | NP_001262966.1 |
Gene: | RpL27 / 43103 |
FlyBaseID: | FBgn0039359 |
Length: | 135 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001041344.1 |
Gene: | LOC306079 / 306079 |
RGDID: | 1564564 |
Length: | 354 |
Species: | Rattus norvegicus |
Alignment Length: | 43 |
Identity: | 11/43 - (25%) |
Similarity: | 18/43 - (41%) |
Gaps: | 7/43 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAG 45
:.|:..::..:..|.:||:...||...|. ..|||.|
Rat 146 RFMEVDRVAYISFGPHAGKLVAIVDVIDQ-------NRALVDG 181
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2163 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.