DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and rpl2702

DIOPT Version :9

Sequence 1:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_588378.1 Gene:rpl2702 / 2539336 PomBaseID:SPCC74.05 Length:136 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:64/136 - (47%)
Similarity:91/136 - (66%) Gaps:1/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAGIDRYPRKVTKKMGKNKLKKK 65
            |.||:|.||:.:|..||:||:|.:|::..|.|:...|||||:|||::|||.||||.||..::.|:
pombe     1 MVKILKPGKVALVTRGRFAGKKVVILQNVDQGSKSHPFGHAVVAGVERYPLKVTKSMGAKRIAKR 65

  Fly    66 SKVKPFLKSLNYNHLMPTRYTAHDISFEKL-SPKDLKDPVKRKTHRFQTRVKFESVYKEGKNKWF 129
            |:||||:|.:||||||||||.....:.:.| :|....:|.:|...:...:..||..|:.||:.||
pombe    66 SRVKPFIKVINYNHLMPTRYALELDNLKGLVTPTTFSEPSQRSAAKKTVKNTFEEKYQTGKSAWF 130

  Fly   130 FQKLRF 135
            |..|||
pombe   131 FTPLRF 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_001262966.1 KOW 1..135 CDD:412330 62/134 (46%)
rpl2702NP_588378.1 KOW 1..136 CDD:294253 62/134 (46%)
RPL14A 1..128 CDD:225074 58/126 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2313
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105144
Inparanoid 1 1.050 139 1.000 Inparanoid score I1376
OMA 1 1.010 - - QHG53799
OrthoFinder 1 1.000 - - FOG0001918
OrthoInspector 1 1.000 - - otm47412
orthoMCL 1 0.900 - - OOG6_101266
Panther 1 1.100 - - O PTHR10497
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1122
SonicParanoid 1 1.000 - - X1272
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.