DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5028 and IDH-IV

DIOPT Version :9

Sequence 1:NP_001097922.1 Gene:CG5028 / 43102 FlyBaseID:FBgn0039358 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_174526.2 Gene:IDH-IV / 840142 AraportID:AT1G32480 Length:214 Species:Arabidopsis thaliana


Alignment Length:208 Identity:83/208 - (39%)
Similarity:124/208 - (59%) Gaps:13/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VREIFRYCGAPIDFEVIDIDPSTEGNDDLDY-AITSIKRNGVALKGNIETKSQSLTEVSRNVAIR 139
            |.::.....||:.||...|  ..:..:.|.: .:.||::|.|.|.|.:   :.||..     ..|
plant    16 VHQVMDAMQAPVYFETYII--KGKNMNHLTWEVVDSIRKNKVCLNGRV---NNSLCG-----GAR 70

  Fly   140 NELDLYVNVVHCKSYPGIPARHHDIDVVLIRQNTDGEYAMLEHESVPGIVESMKV-VTVENAERV 203
            .||||:.::|.|.:..|.|:||.::|:|:||:||:||||..|||.|||::||.:| :|...::|:
plant    71 KELDLFASLVDCFNLNGQPSRHENVDIVVIRENTEGEYAGREHEVVPGVIESFQVTMTKFWSDRI 135

  Fly   204 ARYAFEFARQNNRKKVTTIH-KANIMKLSDGLFLEVANRVHKDYPELEHNNMIIDNTCMQSVSNP 267
            |:||||:|..:.|||||.:| .....||:|..|||....|.|.||.:.:|.:.|:|.|:|.|..|
plant   136 AKYAFEYAHFSKRKKVTAVHNNGKYEKLADAFFLESCQEVAKMYPNITYNEIGINNCCLQLVEKP 200

  Fly   268 HQFDVMNMTNLYG 280
            .:|||:...||||
plant   201 ERFDVIVTPNLYG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5028NP_001097922.1 mito_nad_idh 55..386 CDD:272942 83/208 (40%)
IDH-IVNP_174526.2 Iso_dh 2..>213 CDD:294303 81/206 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11835
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.