DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5028 and IMD3

DIOPT Version :9

Sequence 1:NP_001097922.1 Gene:CG5028 / 43102 FlyBaseID:FBgn0039358 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001322636.1 Gene:IMD3 / 840006 AraportID:AT1G31180 Length:419 Species:Arabidopsis thaliana


Alignment Length:372 Identity:93/372 - (25%)
Similarity:179/372 - (48%) Gaps:52/372 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RHAVTMLPGGGIGPELMGYVREIFR----------------YCGAPIDFEVIDIDPSTEGNDDLD 105
            |:.:|:|||.|||||::...:.:.:                :.||.:|...:.:...|.      
plant    58 RYNITLLPGDGIGPEVISVAKNVLQKAGFLQGLEFDFQEMPFGGAALDLVGVPLPEETS------ 116

  Fly   106 YAITSIKRNGVALKGNI-----ETKSQSLTEVSRNVAIRNELDLYVNVVHCKSYPGIPARH---- 161
               |:.|::...|.|.|     :...:.|......:.||.:|:::.|:......|.:....    
plant   117 ---TAAKQSDAILLGAIGGYKWDKNEKHLRPEMGLLNIRRDLNVFANLRPATVLPQLVDASTLKK 178

  Fly   162 ---HDIDVVLIRQNTDGEY-----AMLEHESVPGIVESMKVVTVENAERVARYAFEFARQNNRKK 218
               ..:|::::|:.|.|.|     .:..:|:...:..:.::......:|:||.|||.||: .|.|
plant   179 EVAQGVDMMIVRELTGGIYFGEPRGITINENGEEVGFNTEIYAAHEIDRIARVAFETARK-RRGK 242

  Fly   219 VTTIHKANIMKLSDGLFLEVANRVHKDYPELEHNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIV 283
            :.::.|||::..|. |:.:....:..:||::|.::|.:||..||.|.:|.|||.:...|::|.|:
plant   243 LCSVDKANVLDASI-LWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDIL 306

  Fly   284 SNVLCGLMGGAGLISGRNYGDH-YAIFEPGTRNTGTAIAGKNIANPVAMISASIDMLNH-LGHKE 346
            |:....:.|..|::...:.|:. ..:||| ...:...|||::.|||:|.|.::..:|.: ||.::
plant   307 SDEASMITGSIGMLPSASLGESGPGLFEP-IHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEK 370

  Fly   347 HANVIQEAVYQTIVNDAIRTPDIGGTNSS----TDVVENILKILSAK 389
            .|.:|::||...: |...||.||....:.    .::.|.:||.:.:|
plant   371 AAKMIEDAVVDAL-NKGFRTGDIYSPGNKLVGCKEMGEEVLKSVDSK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5028NP_001097922.1 mito_nad_idh 55..386 CDD:272942 92/367 (25%)
IMD3NP_001322636.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.