DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5028 and IDH-VI

DIOPT Version :9

Sequence 1:NP_001097922.1 Gene:CG5028 / 43102 FlyBaseID:FBgn0039358 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_850549.1 Gene:IDH-VI / 820139 AraportID:AT3G09810 Length:374 Species:Arabidopsis thaliana


Alignment Length:330 Identity:137/330 - (41%)
Similarity:198/330 - (60%) Gaps:14/330 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TMLPGGGIGPELMGYVREIFRYCGAPID----FEVIDIDPSTEGNDDLDY-AITSIKRNGVALKG 120
            |:.||.|||||:...|:::|......||    |...::||.|  |..|.: .:.|:.:|.|.|||
plant    47 TLFPGDGIGPEIAESVKQVFTAADVVIDWDEQFVGTEVDPRT--NSFLTWDNLQSVLKNKVGLKG 109

  Fly   121 NIET---KSQSLTEVSRNVAIRNELDLYVNVVHCKSYPGIPARHHDIDVVLIRQNTDGEYAMLEH 182
            .:.|   |...    |.|:.:|.||:||.||..|.|.||...|:.|:|::.||:||:|||:.|||
plant   110 PMATPIGKGHR----SLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEYSGLEH 170

  Fly   183 ESVPGIVESMKVVTVENAERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEVANRVHKDYP 247
            :.|.|:|||:|::|.:.:.|||.|||.:|:.:.||||:.|||||||:.:|||||:..:.|...||
plant   171 QVVKGVVESLKIITRKASMRVAEYAFLYAKTHGRKKVSAIHKANIMQKTDGLFLQCCDEVAAKYP 235

  Fly   248 ELEHNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGRNYGDHYAIFEPG 312
            |:.:..::|||.||..|.||..|||:.|.||||.|:|::..||:||.||....|.|:........
plant   236 EIYYEKVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLVGGLGLTPSMNIGEDGIALAEA 300

  Fly   313 TRNTGTAIAGKNIANPVAMISASIDMLNHLGHKEHANVIQEAVYQTIVNDAIRTPDIGGTNSSTD 377
            ...:...|||.|:|||.|::.:.:.||.||...:.|..|..|:..||.....||.|:||::::||
plant   301 VHGSAPDIAGMNLANPTALLLSGVMMLRHLKLNKQAEQIHSAIINTIAEGKYRTADLGGSSTTTD 365

  Fly   378 VVENI 382
            ..:.|
plant   366 FTKAI 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5028NP_001097922.1 mito_nad_idh 55..386 CDD:272942 137/330 (42%)
IDH-VINP_850549.1 PLN00118 3..374 CDD:215062 137/330 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.