powered by:
Protein Alignment CG5028 and AT1G80555
DIOPT Version :9
Sequence 1: | NP_001097922.1 |
Gene: | CG5028 / 43102 |
FlyBaseID: | FBgn0039358 |
Length: | 402 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001322191.1 |
Gene: | AT1G80555 / 5007861 |
AraportID: | AT1G80555 |
Length: | 195 |
Species: | Arabidopsis thaliana |
Alignment Length: | 62 |
Identity: | 17/62 - (27%) |
Similarity: | 31/62 - (50%) |
Gaps: | 15/62 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 RHAVTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDIDPSTEGNDDLDYAITSIKRNGVAL 118
|:.:.:|||.|:|.|:: |:..:|:.:..|.|| :|::...:...||||
plant 40 RYTIAVLPGDGVGNEVI------------PVAVDVLCLAGSLEG---IDFSFEELPIGGVAL 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5028 | NP_001097922.1 |
mito_nad_idh |
55..386 |
CDD:272942 |
17/62 (27%) |
AT1G80555 | NP_001322191.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0473 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D868374at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.