DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5028 and AT1G80555

DIOPT Version :9

Sequence 1:NP_001097922.1 Gene:CG5028 / 43102 FlyBaseID:FBgn0039358 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001322191.1 Gene:AT1G80555 / 5007861 AraportID:AT1G80555 Length:195 Species:Arabidopsis thaliana


Alignment Length:62 Identity:17/62 - (27%)
Similarity:31/62 - (50%) Gaps:15/62 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RHAVTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDIDPSTEGNDDLDYAITSIKRNGVAL 118
            |:.:.:|||.|:|.|::            |:..:|:.:..|.||   :|::...:...||||
plant    40 RYTIAVLPGDGVGNEVI------------PVAVDVLCLAGSLEG---IDFSFEELPIGGVAL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5028NP_001097922.1 mito_nad_idh 55..386 CDD:272942 17/62 (27%)
AT1G80555NP_001322191.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.