DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5028 and Idh3a

DIOPT Version :9

Sequence 1:NP_001097922.1 Gene:CG5028 / 43102 FlyBaseID:FBgn0039358 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_038936589.1 Gene:Idh3a / 114096 RGDID:70889 Length:374 Species:Rattus norvegicus


Alignment Length:336 Identity:129/336 - (38%)
Similarity:199/336 - (59%) Gaps:20/336 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDIDP----------STEGNDDLDYAITSIKRN 114
            ||::||.|||||:...|.:||....|||.:|..::..          ..|..:.:|       :|
  Rat    42 VTLIPGDGIGPEISASVMKIFDAAKAPIQWEERNVTAIQGPGGKWMIPPEAKESMD-------KN 99

  Fly   115 GVALKGNIETKSQSLTEVSRNVAIRNELDLYVNVVHCKSYPGIPARHHDIDVVLIRQNTDGEYAM 179
            .:.|||.::|.. :....|.|:.:|...|||.||..|.|..|....:.|:::|.||:||:|||:.
  Rat   100 KMGLKGPLKTPI-AAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSG 163

  Fly   180 LEHESVPGIVESMKVVTVENAERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEVANRVHK 244
            :||..|.|:|:|:|::|...::|:|.:|||:||.|:|..||.:||||||::||||||:....|.:
  Rat   164 IEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAE 228

  Fly   245 DYPELEHNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGRNYG-DHYAI 308
            :..:::.|.|.:|..|:..|.:|.||||:.|.||||.|:|::..||:||.|:....|.| :..||
  Rat   229 NCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAI 293

  Fly   309 FEPGTRNTGTAIAGKNIANPVAMISASIDMLNHLGHKEHANVIQEAVYQTIVNDAIRTPDIGGTN 373
            || ....|...||||::|||.|::.:::.||.|:|..:||..|:.|.:.||.:....|.|:||.:
  Rat   294 FE-SVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAAKIEAACFATIKDGKSLTKDLGGNS 357

  Fly   374 SSTDVVENILK 384
            ..:|..|.|.:
  Rat   358 KCSDFTEEICR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5028NP_001097922.1 mito_nad_idh 55..386 CDD:272942 129/336 (38%)
Idh3aXP_038936589.1 mito_nad_idh 38..370 CDD:272942 129/336 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X402
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.