DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Mfl1

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_199028.1 Gene:Mfl1 / 834218 AraportID:AT5G42130 Length:412 Species:Arabidopsis thaliana


Alignment Length:307 Identity:93/307 - (30%)
Similarity:150/307 - (48%) Gaps:45/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KMQEPVNKLKFFHALV----AGGVAGMVVDIALFPIDTVKTRLQSE-------------LGFWRA 64
            ::|..:.:|..:...:    |||:||....:.|.|:|.:||:||::             :..::|
plant   100 RIQTLIKQLSVWERAIIGAGAGGLAGAFTYVTLLPLDAIKTKLQTKGASQVYSNTFDAIVKTFQA 164

  Fly    65 GGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHM--AAASAAEVLACLIR 127
            .|..|.|.|::....||..::|::|.|.|.||..||   :..|.|.|.:  .|.:...:::..|.
plant   165 KGILGFYSGVSAVIVGSTFSSAVYFGTCEFGKSLLS---KFPDFPTVLIPPTAGAMGNIISSAIM 226

  Fly   128 VPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFK-- 190
            ||.|:..||.|.  |......|:||:....:|: .|||.|:.:|::|.:|..::.:..:||.|  
plant   227 VPKELITQRMQA--GASGRSYQVLLKILEKDGI-LGLYAGYSATLLRNLPAGVLSYSSFEYLKAA 288

  Fly   191 -LQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIML-AERESLNRRRSA-------- 245
             |:.|..:..:  |.....|||:||.|||.:||||||||||:|. ...|::::...|        
plant   289 VLEKTKQSHLE--PLQSVCCGALAGAISASITTPLDVVKTRLMTQIHVEAVDKLGGAMYTGVAGT 351

  Fly   246 -RRILHGIYLERGFSGLFAGFVPRVLWITLGGAF-FFGFYDLTTRIL 290
             ::||    .|.|:.|...|..|||:......|. :|.|......||
plant   352 VKQIL----TEEGWVGFTRGMGPRVVHSACFSAIGYFAFETARLTIL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 26/92 (28%)
PTZ00168 25..281 CDD:185494 88/288 (31%)
Mito_carr 199..291 CDD:278578 36/103 (35%)
Mfl1NP_199028.1 PTZ00168 132..384 CDD:185494 82/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0768
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.