DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and AT4G11440

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001319903.1 Gene:AT4G11440 / 826748 AraportID:AT4G11440 Length:628 Species:Arabidopsis thaliana


Alignment Length:278 Identity:92/278 - (33%)
Similarity:132/278 - (47%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HALVAGGVAGMVVDIALFPIDTVKTRLQS----ELGFWRAG-------GFRGIYKGLAPAAAGSA 82
            ||. ||.:||:.|.:.|.|:|||||.:||    |......|       ||.|:|:|:|...|.||
plant   329 HAF-AGALAGISVSLCLHPLDTVKTMIQSCRLEEKSLCNTGRSIISERGFSGLYRGIASNIASSA 392

  Fly    83 PTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSG 147
            |.:||:..|||..|..|..:...:.....|..|..:|.:....|..|.|..||:.| :..:.::.
plant   393 PISALYTFTYETVKGTLLPLFPKEYCSLAHCLAGGSASIATSFIFTPSERIKQQMQ-VSSHYRNC 456

  Fly   148 LQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTG-----FDSTPFSVA 207
            ...|:...:..|| ..||.|:.:.:.|.||.|:|:|.::|..|....|..|     ...|.....
plant   457 WTALVGIIQKGGL-LSLYAGWTAVLCRNIPHSIIKFYVYENMKQMVLPSPGPCGEMAQPTTLQTL 520

  Fly   208 LCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWI 272
            .||.:||..:|..|||.||||||:......|.|:..|..:.|..|..:.|..||:.|.:||::..
plant   521 TCGGLAGSAAAFFTTPFDVVKTRLQTQIPGSRNQHPSVYQTLQSIRRQEGLRGLYRGLIPRLVMY 585

  Fly   273 TLGGAFFFGFYDLTTRIL 290
            ...||.||..|:....:|
plant   586 MSQGAIFFASYEFYKSVL 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 34/80 (43%)
PTZ00168 25..281 CDD:185494 89/267 (33%)
Mito_carr 199..291 CDD:278578 32/92 (35%)
AT4G11440NP_001319903.1 PTZ00168 333..599 CDD:185494 88/267 (33%)
Mito_carr 513..604 CDD:395101 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0768
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.