DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and SAMTL

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_850252.1 Gene:SAMTL / 818153 AraportID:AT2G35800 Length:823 Species:Arabidopsis thaliana


Alignment Length:266 Identity:84/266 - (31%)
Similarity:128/266 - (48%) Gaps:13/266 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAGGVAGMVVDIALFPIDTVKTRLQ-SELGFWRA------GGFRGIYKGLAPAAAGSAPTAALFF 89
            :|||:|..:....:.||||:|||:| |.|.|...      .|.||:|:|..||..|...:..|..
plant   546 LAGGLASALSTSLMHPIDTIKTRVQASTLSFPEVIAKLPEIGVRGVYRGSIPAILGQFSSHGLRT 610

  Fly    90 CTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRA 154
            ..:|..|..|.:.........|...|:..:.:|...:|:|.|:.|||.|....|...  :.::..
plant   611 GIFEASKLVLINFAPNLPEIQVQSIASFCSTLLGTAVRIPCEVLKQRLQAGMFNNVG--EAIVGT 673

  Fly   155 YRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAG 219
            ::.:| ..|.:||.|:|:.||:|..::...|:...|.......|.:...:.....|||:|||:|.
plant   674 WKQDG-PSGFFRGTGATLCREVPLYVVGMGLYAESKKMVAQALGRELEAWETIAVGAVSGGIAAV 737

  Fly   220 LTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYD 284
            :|||.||:|||:|.|   :..|..|...::..|....|..|||.|.|||..|:...||..|..|:
plant   738 VTTPFDVMKTRMMTA---TPGRPISMSMVVVSILRNEGPLGLFKGAVPRFFWVAPLGAMNFAGYE 799

  Fly   285 LTTRIL 290
            |..:.:
plant   800 LAKKAM 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 26/73 (36%)
PTZ00168 25..281 CDD:185494 81/255 (32%)
Mito_carr 199..291 CDD:278578 34/92 (37%)
SAMTLNP_850252.1 EFh <339..399 CDD:385324
PTZ00168 542..797 CDD:185494 82/256 (32%)
Mito_carr 719..807 CDD:365909 34/90 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0768
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45667
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.