DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and aralar1

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:314 Identity:88/314 - (28%)
Similarity:130/314 - (41%) Gaps:63/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MQEPVNKLKFFHAL------VAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAG----------- 65
            ::.|.::..|...|      ..|..||.|....::|||.||||:|::    |||           
  Fly   339 VESPADRSAFIQVLESSYRFTLGSFAGAVGATVVYPIDLVKTRMQNQ----RAGSYIGEVAYRNS 399

  Fly    66 -----------GFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDS--PYVHMAAAS 117
                       ||.|:|:||.|...|.||..|:.....:..:   ..:|..|.:  .:..:.|..
  Fly   400 WDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVR---DKLTDKKGNIPTWAEVLAGG 461

  Fly   118 AAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAY---RTEGLKRGLYRGFGSTIMREIPFS 179
            .|.....:...|:||.|.|.| :.|...||.:|  ||:   |..|| .|||:|..:.::|::|||
  Fly   462 CAGASQVVFTNPLEIVKIRLQ-VAGEIASGSKI--RAWSVVRELGL-FGLYKGARACLLRDVPFS 522

  Fly   180 LIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRS 244
            .|.||.:.:.|.......|::. |.::...||:||..:|.|.||.||:|||:.:..|........
  Fly   523 AIYFPTYAHTKAMMADKDGYNH-PLTLLAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTG 586

  Fly   245 ARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFF-----FGF----YDLTTRI 289
            .......|..|.|         ||..|.......|     ||.    |:|..|:
  Fly   587 VWDATKKIMAEEG---------PRAFWKGTAARVFRSSPQFGVTLVTYELLQRL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 28/103 (27%)
PTZ00168 25..281 CDD:185494 82/293 (28%)
Mito_carr 199..291 CDD:278578 27/100 (27%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 28/104 (27%)
PTZ00169 358..631 CDD:240302 84/293 (29%)
Mito_carr 449..539 CDD:278578 29/93 (31%)
Mito_carr 544..633 CDD:278578 27/98 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.