DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG1907

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:300 Identity:79/300 - (26%)
Similarity:121/300 - (40%) Gaps:62/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AAGSV--AIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQ-SELGF----WRAG-- 65
            :|.||  |.|.....|.:||    :.||::||...:.:.|:|.||||:| |..|.    :|:.  
  Fly     2 SATSVQEAPKKAVATNAIKF----LFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLH 62

  Fly    66 ---------GFRGIYKGLAPAAAGSAPTAALFFCTYECGK----QFLSSVTQTK--DSPYV--HM 113
                     |...:|:|:..|....|        ||..|:    .:|:.:.:.|  .||.:  .|
  Fly    63 CIQTIVSKEGPLALYQGIGAALLRQA--------TYTTGRLGMYTYLNDLFREKFQRSPGITDSM 119

  Fly   114 AAASAAEVLACLIRVPVEIAKQRSQTLQG--------NKQSGLQILLRAYRTEGLKRGLYRGFGS 170
            |..:.|......|..|.|:|..| .|..|        |..:....|.|..|.||| ..|:||...
  Fly   120 AMGTIAGACGAFIGTPAEVALVR-MTSDGRLPVAERRNYTNVANALARITREEGL-TALWRGSLP 182

  Fly   171 TIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVA------LCGAVAGGISAGLTT-PLDVVK 228
            |:.|.:..::.|...:..||      |.|...|..:.      .|.::..|:...:|: |||:.|
  Fly   183 TVGRAMVVNMTQLASYSQFK------TYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAK 241

  Fly   229 TRIM-LAERESLNRRRSARRILHGIYLERGFSGLFAGFVP 267
            |||. :...:.....|....:|..:..:.|...|:.||.|
  Fly   242 TRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/95 (26%)
PTZ00168 25..281 CDD:185494 72/282 (26%)
Mito_carr 199..291 CDD:278578 18/76 (24%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 26/104 (25%)
Mito_carr 118..207 CDD:278578 27/96 (28%)
Mito_carr 219..307 CDD:278578 16/62 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441982
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.