DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG5805

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:338 Identity:82/338 - (24%)
Similarity:136/338 - (40%) Gaps:76/338 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AELGLESAA-GSVAIKMQE--PVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSE------ 58
            |..|:..|| |:..|:..|  .:||.|||...:   ::...|...|||:..:||:||.:      
  Fly    15 APTGVGGAAEGATYIRTIEWDMMNKTKFFPLSM---LSSFSVRCCLFPLTVIKTQLQVQHKSDVY 76

  Fly    59 -------LGFWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVH---- 112
                   :..:|:.|..|:|:|...::. ...:...:..|||..:..|:      |....|    
  Fly    77 KGMVDCAMKIYRSEGVPGLYRGFWISSV-QIVSGVFYISTYEGVRHVLN------DLGAGHRMKA 134

  Fly   113 MAAASAAEVLACLIRVPVEIAKQRSQTL-----QGNK-------------QSGLQILL----RAY 155
            :|....|.::...|.||.::..|.:..|     .|:|             :|.|.|.:    ...
  Fly   135 LAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIM 199

  Fly   156 RTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTP------FSVALCGAVAG 214
            |.:|. ||.|||:.:::|..:|.|.:   .|.::.|....|  |...|      |...:.|::.|
  Fly   200 RRDGF-RGFYRGYTASLMAYVPNSAM---WWAFYHLYQDEL--FRICPVWVSHLFIQCVAGSLGG 258

  Fly   215 GISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFF 279
            ..:..||.|||:|:.|:.:...:|::  .:.|.:.....|...|.||.|..|.       ..||.
  Fly   259 FTTTILTNPLDIVRARLQVHRLDSMS--VAFRELWQEEKLNCFFKGLSARLVQ-------SAAFS 314

  Fly   280 FGF---YDLTTRI 289
            |..   |:...||
  Fly   315 FSIILGYETIKRI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 21/88 (24%)
PTZ00168 25..281 CDD:185494 69/300 (23%)
Mito_carr 199..291 CDD:278578 26/100 (26%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 17/88 (19%)
Mito_carr 132..238 CDD:395101 25/111 (23%)
Mito_carr 245..327 CDD:395101 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.