DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Dic1

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:268 Identity:71/268 - (26%)
Similarity:115/268 - (42%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGVAGMVVDIALFPIDTVKTRLQSELG----------FWRAGGFRGIYKGLAPAAAGSAPTAALF 88
            ||:|.:...:...|:|.:|..||::.|          ..|..|....|.||:.:.......:...
  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTYSTAR 77

  Fly    89 FCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQT-------LQGNKQS 146
            |..||.||:::::     ||....:|.|.|:.::..::..|.::...|.|.       .:.|..:
  Fly    78 FGVYEAGKKYVNT-----DSFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNN 137

  Fly   147 GLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDS---TPFSVAL 208
            ....|:|.||.||.|| |:.|..:...|.|..::.|...::..|:.......|..   |.|:.:|
  Fly   138 AFDGLVRVYRQEGFKR-LFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLVTHFTASL 201

  Fly   209 CGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIY------LERGFSGLFAGFVP 267
               |||.|:..||.||||:|||.|.|:....|          |::      .:.|..|.|.|:||
  Fly   202 ---VAGTIATTLTQPLDVLKTRSMNAKPGEFN----------GLWDIVKHTAKLGPLGFFKGYVP 253

  Fly   268 RVLWITLG 275
              .::.||
  Fly   254 --AFVRLG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 19/74 (26%)
PTZ00168 25..281 CDD:185494 71/268 (26%)
Mito_carr 199..291 CDD:278578 29/86 (34%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 19/83 (23%)
PTZ00169 13..273 CDD:240302 71/268 (26%)
Mito_carr 89..184 CDD:278578 23/100 (23%)
Mito_carr 189..278 CDD:278578 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.