DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Dic4

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:281 Identity:70/281 - (24%)
Similarity:112/281 - (39%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGVAGMVVDIALFPIDTVKTRLQ------SELG----FWRAGGFRGIYKGLAPAAAGSAPTAALF 88
            ||.|.|.|..|:.|||.|||.:|      |.||    .....|:.|.|.|.:.|......:..:.
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQRQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMTSTNIH 90

  Fly    89 FCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACL-------IRVPVEIAKQRSQT------- 139
            |..|:.||:.          .||...:.....:|.|:       ..:|.::...|.||       
  Fly    91 FIVYDTGKKM----------EYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPPY 145

  Fly   140 LQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTP-LTGFDSTP 203
            .:.|.:.....|:|..:.||.| .||:|....:.:....:..|...::..|.:... ::..|..|
  Fly   146 KRRNYKHVFDGLIRIPKEEGWK-ALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLP 209

  Fly   204 --FSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILH--GIYLER-GFSGLFA 263
              |..:|..::   ||:.:|.|||||:|.:|       |.|....|.:.  .:::.| |..|.:.
  Fly   210 LHFLTSLGTSI---ISSAITHPLDVVRTIMM-------NSRPGEFRTVFQASVHMMRFGVMGPYR 264

  Fly   264 GFVPRVLWITLGGAFFFGFYD 284
            ||||.::.........|..|:
  Fly   265 GFVPTIVRKAPATTLLFVLYE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/74 (34%)
PTZ00168 25..281 CDD:185494 68/276 (25%)
Mito_carr 199..291 CDD:278578 26/91 (29%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 70/281 (25%)
Mito_carr 26..100 CDD:278578 25/73 (34%)
Mito_carr 104..201 CDD:278578 17/97 (18%)
Mito_carr 211..292 CDD:278578 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.