DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG6893

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:271 Identity:66/271 - (24%)
Similarity:103/271 - (38%) Gaps:61/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AGGVAGMVVDIALFPIDTVKTR-------------LQSELGFWRAGGFRGIYKGLAPAAAGSAPT 84
            :|||||.:......|.|.::.|             ||..:   |..||..:|.||:.........
  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQAI---RTHGFISLYDGLSAQLLRQLTY 81

  Fly    85 AALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQT-------LQG 142
            .::.|..||.||:.|.......|...|    |:.|..:|.::..|:|:...|.|.       .:.
  Fly    82 TSMRFHLYEMGKEHLDDPAGLLDKVLV----AALAGCVAGVVGTPMELINTRMQVNRALPKETRW 142

  Fly   143 NKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLW--------EYFKLQW-TPLTG 198
            |.::....|.|..|.||..: ||.|...:.||....::.|...:        |:|.::. ..|..
  Fly   143 NYRNVFDGLYRVTREEGFTK-LYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLLH 206

  Fly   199 FDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLN--RRRSARRILHGI-YLER-GFS 259
            ..|:..:..:||.:...|                    |:|.  |...:||:::.| |:.| |..
  Fly   207 LISSVTAAFVCGPIIKPI--------------------ENLRYLRMVDSRRLINSISYMMRFGSR 251

  Fly   260 GLFAGFVPRVL 270
            |.|.|.||.||
  Fly   252 GPFRGMVPYVL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 21/78 (27%)
PTZ00168 25..281 CDD:185494 66/271 (24%)
Mito_carr 199..291 CDD:278578 20/76 (26%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 21/78 (27%)
Mito_carr 98..192 CDD:395101 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.