DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Bmcp

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:321 Identity:82/321 - (25%)
Similarity:136/321 - (42%) Gaps:81/321 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQ----------SELGF----------WRAGG 66
            :.::|.:...|.||||.:..:...|||||.|||||          |:|.:          .|..|
  Fly     1 MGEVKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEG 65

  Fly    67 FRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSS----VTQT-KDSPYVHMAAASAAEVLACLI 126
            .|.:|.|:.||....|....:.|.||...|:..:.    :.:. .:..:.::..|:||..::..|
  Fly    66 LRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAI 130

  Fly   127 RVPVEIAKQRSQTLQGNKQSGL-----QILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLW 186
            ..|.::.|.|.|.....:..||     :|    |:.||: |||:||.|.|..|.:..:.::.|::
  Fly   131 ANPTDVLKVRMQVHGKGQHKGLLGCFGEI----YKYEGV-RGLWRGVGPTAQRAVVIASVELPVY 190

  Fly   187 EYFKLQWTPLTG------FDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSA 245
            ::.|||.....|      |.|: |..:|..|:|       :||:||::||:|        .:|..
  Fly   191 DFCKLQLMNAFGDHVGNHFISS-FIASLGSAIA-------STPIDVIRTRLM--------NQRPV 239

  Fly   246 RRILHGIYL--------------------ERGFSGLFAGFVPRVLWITLG--GAFFFGFYD 284
            ...::|:..                    ..|...|:.||:|  .|:.:|  ...||..|:
  Fly   240 SITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIP--TWVRMGPWNIIFFITYE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 30/95 (32%)
PTZ00168 25..281 CDD:185494 80/313 (26%)
Mito_carr 199..291 CDD:278578 25/108 (23%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 29/89 (33%)
Mito_carr <132..199 CDD:278578 22/71 (31%)
Mito_carr 204..303 CDD:278578 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.