DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG7514

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:298 Identity:71/298 - (23%)
Similarity:116/298 - (38%) Gaps:52/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAGGVAGMVVDIALFPIDTVKTRLQSE-------------LGFWRAGGFRGIYKGLAPAAAGSA- 82
            :.||:|||:....:.|:|.||||:|..             |..::..|...:|.||:......| 
  Fly    17 INGGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQAT 81

  Fly    83 -PTAALFFCTYECG---KQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQT---- 139
             .||.:.|...|..   |||.:..|     ....|.....|.....:...|.|:|..|..:    
  Fly    82 YTTARMGFYQMEIDAYRKQFNAPPT-----VLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRL 141

  Fly   140 ---LQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDS 201
               .:.|....|...:|..:.||:.. |::|...|:.|.:..:::|...:...|..:       |
  Fly   142 PPAERRNYTGVLNAFVRIVKDEGVIT-LWKGCMPTVGRAMIVNMVQLASYSQLKAAF-------S 198

  Fly   202 TPFSVALCGAVAGGISAGLTT-----PLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGL 261
            ..|| .|...:|..:.:||.|     |||:.||||   :::.....:....:|..:....|.:.|
  Fly   199 EYFS-GLSLHIAAAMMSGLLTTIASMPLDMAKTRI---QQQKTAEYKGTMDVLMKVSKNEGIASL 259

  Fly   262 FAGFVPRVLWITLGGAFFFGFYDLTTR-----ILGATS 294
            :.||.|.:..:.....|.|.|.:..|:     :||..|
  Fly   260 WKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIVLGDDS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 24/84 (29%)
PTZ00168 25..281 CDD:185494 65/278 (23%)
Mito_carr 199..291 CDD:278578 25/101 (25%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 68/286 (24%)
Mito_carr 19..90 CDD:278578 20/70 (29%)
Mito_carr 104..201 CDD:278578 19/109 (17%)
Mito_carr 207..284 CDD:278578 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.