DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Shawn

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:365 Identity:81/365 - (22%)
Similarity:145/365 - (39%) Gaps:90/365 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAELGLESAAGSVAIK--MQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSE------ 58
            ||...:.:|:.....|  |.:|..:::....:.:.....||....:.|:|.:|||||::      
  Fly    12 AASAAMAAASSQNPSKATMTDPRFRIRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLS 76

  Fly    59 ----------------------------------------LGFWRAGGFRGIYKGLAPAAAGSAP 83
                                                    :...|..|...::.||:|....:.|
  Fly    77 NKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALP 141

  Fly    84 TAALFFCTYECGKQFLSSV---------TQTKDSPY-----VHMAAASAAEVLACLIRVPVEIAK 134
            :..::|..||..|...:.:         |...|.|:     |.:.|..:..:||.....|||:.:
  Fly   142 STIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIR 206

  Fly   135 QRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGF 199
            .:.|:.:.........:.:..:::|: .||:||...||:|::|||.|.:..:||.|..:    |.
  Fly   207 TKMQSQRMTHAEMFGTIRQVVQSQGV-LGLWRGLPPTILRDVPFSGIYWTCYEYLKSSF----GV 266

  Fly   200 DSTPFSVAL-CGAVAGGISAGLTTPLDVVKT--RIMLAER--------ESLNRRRSARRILHGIY 253
            ....||.:. .||::|.::|.:|||.|||||  :|...|:        :.:..:..|.| |..||
  Fly   267 VEPTFSFSFAAGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMR-LASIY 330

  Fly   254 LERGFSGLFAGFVPRVLWIT-----------LGGAFFFGF 282
            ...|...:|:|..||:..:.           .|.:||:.:
  Fly   331 RMGGVPAIFSGLGPRLFKVAPACAIMISSFEYGKSFFYHY 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 19/121 (16%)
PTZ00168 25..281 CDD:185494 75/337 (22%)
Mito_carr 199..291 CDD:278578 29/106 (27%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 19/119 (16%)
Mito_carr 178..265 CDD:278578 23/91 (25%)
Mito_carr 268..371 CDD:278578 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.