DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Tyler

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:405 Identity:77/405 - (19%)
Similarity:134/405 - (33%) Gaps:151/405 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWR--------------------- 63
            :|..::|....:|:..|.|::....:.|::.||||:|::....:                     
  Fly    38 DPRYRIKPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCR 102

  Fly    64 -------------------------------AGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQ 97
                                           ..||.|::.||:|....:.|:..::|.|||..|.
  Fly   103 SSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKN 167

  Fly    98 FLSSV---------------------------------------TQTKDSP-YVHMAAASAAEVL 122
            .||.:                                       ..|...| ||.||:...:..:
  Fly   168 SLSHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTI 232

  Fly   123 ACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWE 187
            ......|:|:.:.:.|:.........::|....|..|: .||:||:..|:||:.|||...:.::|
  Fly   233 VVTAITPIEMVRIKMQSEYMTYAELWRVLRSLIRQHGI-LGLWRGWPPTVMRDAPFSGTYWAVYE 296

  Fly   188 YFKLQWTPLTGFDSTPFSVA--------LCGAVAGGISAGLTTPLDVVKTRIMLAERESL----- 239
            ..|           ..|||.        |.||::|.::..:|.|.|::.|...:...:.:     
  Fly   297 AIK-----------RAFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEI 350

  Fly   240 ------------------------NRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAF-- 278
                                    |.|.|....:..||..:|..||:.|.:||:|.:....|.  
  Fly   351 GAGTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMI 415

  Fly   279 --------FFGFYDL 285
                    ||..|:|
  Fly   416 STFEYSKSFFFHYNL 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 22/127 (17%)
PTZ00168 25..281 CDD:185494 73/394 (19%)
Mito_carr 199..291 CDD:278578 28/134 (21%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 23/129 (18%)
Mito_carr 216..302 CDD:278578 23/97 (24%)
Mito_carr 306..429 CDD:278578 23/122 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.