DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG18327

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:311 Identity:77/311 - (24%)
Similarity:110/311 - (35%) Gaps:90/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAGGVAGMVVDIALFPIDTVKTR--LQSELG------------------FWRAGGFRGIYKGLAP 76
            |.||||.|...:...|::.:|||  ||.||.                  ..:..|..|:.|||||
  Fly     7 VLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAP 71

  Fly    77 AAAGSAPTAALFFCTYECGKQF------LSSVTQTKDSPYVH--------------------MAA 115
                     ||.|       ||      ||..|...:..:||                    :.:
  Fly    72 ---------ALCF-------QFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGS 120

  Fly   116 ASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSL 180
            ..|:.......::..:.|||.:...|....|....:.:.||..|: .||:||..:.:.|....|.
  Fly   121 YCASPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGV-FGLWRGSLANVSRATVASA 184

  Fly   181 IQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLT-TPLDVVKTRIMLAERESLNRRRS 244
            :|..::...| ......|..:.|..::.|..:|.|....|. ||||||.||:.....::..|   
  Fly   185 VQIAVFGQAK-SLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGR--- 245

  Fly   245 ARRILHGIYL------------ERGFSGLFAGFVPRVL----WITLGGAFF 279
                  |||.            ..|..||:.||.|..|    :.||...||
  Fly   246 ------GIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 26/92 (28%)
PTZ00168 25..281 CDD:185494 77/311 (25%)
Mito_carr 199..291 CDD:278578 28/98 (29%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 28/95 (29%)
PTZ00169 5..293 CDD:240302 77/311 (25%)
Mito_carr 101..201 CDD:278578 17/101 (17%)
Mito_carr 204..296 CDD:278578 28/96 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.