DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG8323

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:328 Identity:76/328 - (23%)
Similarity:111/328 - (33%) Gaps:118/328 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAGGVAGMVVDIALFPIDTVKTR--LQSEL-----------GFWRA-------GGFRGIYKGLAP 76
            |.||:|.:.......||:.:|||  ||.||           |...|       .|..|:.|||||
  Fly     7 VLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAP 71

  Fly    77 AAAGSAPTAALFFCTYECGKQF------LSSVTQTKDSPYVH-----------MAAASAAEVLAC 124
                     ||:|       ||      ||..::..:..::|           :...:...|:.|
  Fly    72 ---------ALYF-------QFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGC 120

  Fly   125 LIRVPVEIAKQRSQTLQGNKQ----------SGLQILLRAYRTEGLKRGLYRG------------ 167
            ....|..:.|.:.|: |..||          |....|.:.|...|: |||:||            
  Fly   121 YFSSPFFLIKTQLQS-QAAKQIAVGYQHAHTSMTDALRQIYSRNGV-RGLWRGSVAALPRAALGS 183

  Fly   168 ------FGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDV 226
                  ||.|....:.:.|:..|....|.                  .|.:||.|.:...||.||
  Fly   184 GAQIATFGKTKALLVQYDLVTQPTLNSFS------------------AGLIAGSIMSVAITPPDV 230

  Fly   227 VKTRIMLAERESLNRRRSA--RRILHGIYLE--------RGFSGLFAGFVPRVLWITLGGAFFFG 281
            :.||:       .|:...|  |.:|:..:|:        .|..|::.||....|.|.........
  Fly   231 ITTRL-------YNQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLL 288

  Fly   282 FYD 284
            |:|
  Fly   289 FFD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 27/92 (29%)
PTZ00168 25..281 CDD:185494 74/323 (23%)
Mito_carr 199..291 CDD:278578 23/96 (24%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 29/95 (31%)
PTZ00169 5..293 CDD:240302 76/328 (23%)
Mito_carr 101..200 CDD:278578 20/100 (20%)
Mito_carr 206..301 CDD:278578 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.