DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and MME1

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:310 Identity:87/310 - (28%)
Similarity:133/310 - (42%) Gaps:45/310 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VAIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQS------------------ELG 60
            |.|..::..|.:|.|   :||||.||...:...|:||:|.|||:                  ...
  Fly     4 VEISTEKKSNPVKSF---IAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAAR 65

  Fly    61 FWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDS-----PYVHMAAASAAE 120
            .:|..||||.|:|::....|..|..|:.|..|..||:..    ||.|.     |.: .||.:.|.
  Fly    66 TFRYEGFRGFYRGISAPLVGVTPIYAVDFAVYAAGKRLF----QTDDHIRLTYPQI-FAAGALAG 125

  Fly   121 VLACLIRVPVEIAK--QRSQTLQGNK---QSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSL 180
            |.:.|:.||.:..|  .::||:....   ...:....:.||..|: |.|::|..:.|:|:.|.. 
  Fly   126 VCSALVTVPTDRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGI-RSLFKGTCACILRDSPTG- 188

  Fly   181 IQFPLWEYFK--LQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRR 243
            ..|..:|:.:  .:.....|..||. |..|.|..||.:...|..|.||:|:|:..|...:.  :.
  Fly   189 FYFVTYEFLQELARKKSANGKISTT-STILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTY--KH 250

  Fly   244 SARRILHGIYLERGFSGLFAGFVPRVL-WITLGGAFFFGFYDLTTRILGA 292
            ..|.:...:....|...||.|.:|.:| ......|.||| .:||..:|.|
  Fly   251 GIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFG-VELTNDLLKA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 30/93 (32%)
PTZ00168 25..281 CDD:185494 78/286 (27%)
Mito_carr 199..291 CDD:278578 27/92 (29%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 31/103 (30%)
Mito_carr 111..205 CDD:278578 22/96 (23%)
Mito_carr 208..297 CDD:278578 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.