DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Ucp4C

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:298 Identity:67/298 - (22%)
Similarity:117/298 - (39%) Gaps:55/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSE------------------LGFWRAGG 66
            :|:.....|...|...:...:.:..:||:|..|||:|.:                  ....|..|
  Fly    29 DPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEG 93

  Fly    67 FRGIYKGLAPAAAGSAPTAALFFCTYECGKQ-FLSSVTQTKDSPYVHMA--AASAAEVLACLIRV 128
            |:.:|.|.:.....:....:|....|:..:: ||....:.::...::||  .:..|..:|..:..
  Fly    94 FKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALAN 158

  Fly   129 PVEIAKQRSQTLQGNKQSG--------LQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPL 185
            |.:|.|.|.||....:|.|        :|..:..||..||. .:::|.|.:.||....:......
  Fly   159 PFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLP-SMWKGVGPSCMRACLMTTGDVGS 222

  Fly   186 WEYFKLQWTPLTGFDS---TPFSVALCGAVAGGISAGLTTPLDVVKTRIM----------LAERE 237
            ::..|..:..|...:.   ..|..::|   ||..::.|:||.||:|:|:|          |..:.
  Fly   223 YDISKRTFKRLLDLEEGLPLRFVSSMC---AGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKN 284

  Fly   238 SLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLG 275
            ||:..|...|       |.|...|:.|.:|  .|..||
  Fly   285 SLDCVRKLVR-------EEGVLTLYKGLMP--TWFRLG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 16/94 (17%)
PTZ00168 25..281 CDD:185494 66/293 (23%)
Mito_carr 199..291 CDD:278578 25/90 (28%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 14/74 (19%)
Mito_carr 137..232 CDD:278578 22/95 (23%)
Mito_carr 237..329 CDD:278578 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.