DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Rim2

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:346 Identity:85/346 - (24%)
Similarity:135/346 - (39%) Gaps:92/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LVAGGVAGMVVDIALFPIDTVKTRLQSELGFW-------RAGGF--------------------- 67
            |:|||.||.|..:...|::.|||||||...|.       .|||.                     
  Fly    12 LIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTT 76

  Fly    68 ------------------------------------------------RGIYKGLAPAAAGSAPT 84
                                                            |.::|||.|...|.||:
  Fly    77 ILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPS 141

  Fly    85 AALFFCTYECGKQFLSSV-TQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNK--QS 146
            .|::||||...|..|:|: ...:|||.||:.:|::|..::.....|:...|.|.|....:|  .:
  Fly   142 RAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLDYNSKVQMT 206

  Fly   147 GLQILLRAYRTEGLK---RGL---YRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGF-DSTPF 204
            ..|.:.|.|...|:.   :|:   |.|...|::..:.:..|:..|.|....:.|...|. |...|
  Fly   207 VRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRDFLEF 271

  Fly   205 SVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRV 269
            .:|  |||:..|::.:..|.:|.:||:    ||..|:..|..:.||.::.|.|.:||:.|...::
  Fly   272 MMA--GAVSKTIASCIAYPHEVARTRL----REEGNKYNSFWQTLHTVWKEEGRAGLYRGLATQL 330

  Fly   270 LWITLGGAFFFGFYDLTTRIL 290
            :......|.....|:....:|
  Fly   331 VRQIPNTAIMMATYEAVVYVL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 33/143 (23%)
PTZ00168 25..281 CDD:185494 83/335 (25%)
Mito_carr 199..291 CDD:278578 25/93 (27%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 33/143 (23%)
Mito_carr 163..253 CDD:278578 22/89 (25%)
Mito_carr 268..355 CDD:278578 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.