DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Ant2

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:291 Identity:70/291 - (24%)
Similarity:119/291 - (40%) Gaps:40/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FFHALVAGGVAGMVVDIALFPIDTVKTRLQSE-------------------LGFWRAGGFRGIYK 72
            |....:.|||:..:...|:.||:.||..||.:                   :...:..||...::
  Fly    18 FLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWR 82

  Fly    73 GLAPAAAGSAPTAALFFCTYECGKQ-FLSSVTQTKDSPYVH----MAAASAAEVLACLIRVPVEI 132
            |.........||.||.|...:..|. ||..|.:.|.. :.|    :|:..||...:.....|::.
  Fly    83 GNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQF-WRHFAGNLASGGAAGATSLCFVYPLDF 146

  Fly   133 AKQRSQT---LQGNKQ-SGL-QILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQ 192
            |:.|...   ..||:: :|| ..|::..:::| ..||||||..::...:.:....|..::..:  
  Fly   147 ARTRLAADVGKGGNREFNGLIDCLMKVIKSDG-PIGLYRGFIVSVQGIVIYRAAYFGFYDTCR-- 208

  Fly   193 WTPLTGFDSTPFSVALCGAVAGGISAGLTT-PLDVVKTRIML---AERESLNRRRSARRILHGIY 253
             ..|....||||.|:...|......||:.: |.|.|:.|:|:   .::..:..:.:|...| .|.
  Fly   209 -DFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWL-VIA 271

  Fly   254 LERGFSGLFAGFVPRVLWITLGGAFFFGFYD 284
            .:.|....|.|.:..::..| |||.....||
  Fly   272 KQEGIGAFFKGALSNIIRGT-GGALVLALYD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 20/91 (22%)
PTZ00168 25..281 CDD:185494 68/286 (24%)
Mito_carr 199..291 CDD:278578 25/90 (28%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 70/291 (24%)
Mito_carr 17..111 CDD:278578 21/92 (23%)
Mito_carr 119..215 CDD:278578 21/100 (21%)
Mito_carr 218..307 CDD:278578 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.