DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and sesB

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:326 Identity:80/326 - (24%)
Similarity:136/326 - (41%) Gaps:54/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLESAAGSVAIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSE----------- 58
            :|..||:.:...||.:..:.:.|.....|||::..|...|:.||:.||..||.:           
  Fly     1 MGNISASITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQ 65

  Fly    59 --------LGFWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQ-FLSSVTQ-TKDSPYV-- 111
                    :...:..||...::|.........||.||.|...:..|| ||..|.: |:...|.  
  Fly    66 YKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAG 130

  Fly   112 HMAAASAAEVLACLIRVPVEIAKQR--SQTLQGNKQ--SGL-QILLRAYRTEGLKRGLYRGFGST 171
            ::|:..||...:.....|::.|:.|  :.|.:|.::  :|| ..|.:.::::|:. |||||||.:
  Fly   131 NLASGGAAGATSLCFVYPLDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIV-GLYRGFGVS 194

  Fly   172 IMREIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLTT-PLDVVKTRIMLAE 235
            :...|.:....|..::..:   ..|....:||..::...|......||:.: |.|.|:.|:|:  
  Fly   195 VQGIIIYRAAYFGFYDTAR---GMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMM-- 254

  Fly   236 RESLNRRRSARRILHGIY-----------LERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRI 289
                   :|.|:....||           .:.|....|.|....:|..| ||||....||...::
  Fly   255 -------QSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGT-GGAFVLVLYDEIKKV 311

  Fly   290 L 290
            |
  Fly   312 L 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 22/95 (23%)
PTZ00168 25..281 CDD:185494 72/295 (24%)
Mito_carr 199..291 CDD:278578 26/104 (25%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 23/96 (24%)
PTZ00169 23..312 CDD:240302 74/302 (25%)
Mito_carr 124..220 CDD:278578 23/99 (23%)
Mito_carr 223..312 CDD:278578 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.