DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG5254

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:291 Identity:74/291 - (25%)
Similarity:114/291 - (39%) Gaps:64/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LVAGGVAGMVVDIALFPIDTVKTRLQ---------SELG-------------FWRAGGFRGIYKG 73
            ::|||.||.:....:.|:|.||||:|         :.||             .:|..|....:||
  Fly    18 VLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKG 82

  Fly    74 LAPAAAGSAPTAALFFCTYECGK---QFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQ 135
            :.|......|..|:.|..:|..|   || .|.|.|   |.....|...|..|..:...|.|:.|.
  Fly    83 IMPPILAETPKRAIKFLVFEQTKPLFQF-GSPTPT---PLTFSLAGLTAGTLEAIAVNPFEVVKV 143

  Fly   136 RSQTLQGNKQ-SGLQILLRAYRTEGLK-RGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTG 198
            ..|..:..|. |...:.....:.:||. .||.:|..:|:.|...|:::.|..:...|        
  Fly   144 AQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVK-------- 200

  Fly   199 FDSTP---------FSVALCGAVAGGISAGLTTPLDVVKTRI--------MLAERESLNRRRSAR 246
             :..|         ......|.:||.::..:..|.||.|:||        .:..|.:|    |:.
  Fly   201 -NVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTL----SSM 260

  Fly   247 RILHGIYLERGFSGLFAGFVPRVLWITLGGA 277
            .|   :|.|.||..|:.|.||:::.:..|||
  Fly   261 GI---VYREEGFRALYKGLVPKIMRLGPGGA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/92 (27%)
PTZ00168 25..281 CDD:185494 74/291 (25%)
Mito_carr 199..291 CDD:278578 25/96 (26%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 26/94 (28%)
PTZ00169 19..301 CDD:240302 74/290 (26%)
Mito_carr 122..207 CDD:278578 20/93 (22%)
Mito_carr 209..305 CDD:278578 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.