DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and SLC25A26

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001337920.1 Gene:SLC25A26 / 115286 HGNCID:20661 Length:274 Species:Homo sapiens


Alignment Length:264 Identity:137/264 - (51%)
Similarity:172/264 - (65%) Gaps:3/264 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FFHALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAGGFRGIYKGLAPAAAGSAPTAALFFCT 91
            |..|||||||||:.||:.|||:||:||||||..||.:||||.|||.|:..||.||.|.||.||.|
Human     6 FVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGSFPNAAAFFIT 70

  Fly    92 YECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAYR 156
            ||..|.||.:.:.:..:|..||.||||.||:|||||||.|:.|||:|.....:.  .||......
Human    71 YEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSASTRT--FQIFSNILY 133

  Fly   157 TEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLT 221
            .||: :|||||:.||::|||||||:||||||..|..|:.........:..|:|||.|||.:|.:|
Human   134 EEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVCGAFAGGFAAAVT 197

  Fly   222 TPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLT 286
            |||||.||||.||:..|.....:...:|||::..:|.:|||||..||:..|:|||..|.|.||.|
Human   198 TPLDVAKTRITLAKAGSSTADGNVLSVLHGVWRSQGLAGLFAGVFPRMAAISLGGFIFLGAYDRT 262

  Fly   287 TRIL 290
            ..:|
Human   263 HSLL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 46/71 (65%)
PTZ00168 25..281 CDD:185494 132/253 (52%)
Mito_carr 199..291 CDD:278578 42/92 (46%)
SLC25A26NP_001337920.1 Solcar 1 4..77 46/70 (66%)
PTZ00168 10..258 CDD:185494 130/250 (52%)
Solcar 2 86..168 46/84 (55%)
Solcar 3 177..265 41/87 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146377
Domainoid 1 1.000 89 1.000 Domainoid score I7892
eggNOG 1 0.900 - - E1_KOG0768
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6834
Inparanoid 1 1.050 252 1.000 Inparanoid score I3223
Isobase 1 0.950 - 0 Normalized mean entropy S762
OMA 1 1.010 - - QHG53824
OrthoDB 1 1.010 - - D1538959at2759
OrthoFinder 1 1.000 - - FOG0004001
OrthoInspector 1 1.000 - - oto88342
orthoMCL 1 0.900 - - OOG6_102662
Panther 1 1.100 - - LDO PTHR45667
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1767
SonicParanoid 1 1.000 - - X2764
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.