DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and AZF1

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_014756.3 Gene:AZF1 / 854280 SGDID:S000005639 Length:914 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:58/282 - (20%)
Similarity:103/282 - (36%) Gaps:77/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QLREIFVATEANTEQEDDVEDEENEADMNEEFLMEEIEEKQETPIDSLEDIVPR----NRHTGKS 181
            |.|:.....:.||.|:.|:...:.         |:.:..|.|. :..:|.  |:    .|...|.
Yeast   541 QARKKGFTEKVNTTQDGDLLFNQT---------MDILPPKSEL-VGGVEK--PKGTQNTRAVKKH 593

  Fly   182 NCKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKV 246
            .|.:||:.|...:.:..|...|:..:|                             ..||.|||.
Yeast   594 ECPYCHRLFSQATHLEVHVRSHIGYKP-----------------------------FVCDYCGKR 629

  Fly   247 FAIAKALEIHKRYHNRDFPYSCDLCDRRFAQR----SHLTVHQQVKHSGSRFICEFPGCQKSFTS 307
            |.....|..|:|.|..:.|||||:||::|:::    :||..||::|    .|:|:...|.|:||.
Yeast   630 FTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLK----PFVCKLENCNKTFTQ 690

  Fly   308 SSSLRNHECTHTAMPFECAHCHQSYPARNKLRMHLERKHNMVVQMEDLEEMRKFHIVRSKLV--M 370
            ..:::.|:                      .|.|.|..:.:..::.::.......:...:|:  .
Yeast   691 LGNMKAHQ----------------------NRFHKETLNALTAKLAEMNPSENIPLEERQLLEYF 733

  Fly   371 AKIYSDQKESHHAKNDSAAISK 392
            |.||.:.......:.......|
Yeast   734 ASIYKNSNRGIKGRGKGVGTKK 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 1/2 (50%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..232 CDD:275368 0/19 (0%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
C2H2 Zn finger 268..289 CDD:275368 9/24 (38%)
C2H2 Zn finger 296..318 CDD:275368 6/21 (29%)
C2H2 Zn finger 325..346 CDD:275368 3/20 (15%)
AZF1NP_014756.3 COG5048 342..768 CDD:227381 58/282 (21%)
C2H2 Zn finger 595..615 CDD:275368 5/19 (26%)
C2H2 Zn finger 623..643 CDD:275368 9/19 (47%)
C2H2 Zn finger 651..671 CDD:275368 7/19 (37%)
C2H2 Zn finger 679..702 CDD:275368 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.