DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and Zfp1

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017456932.1 Gene:Zfp1 / 498952 RGDID:1565049 Length:487 Species:Rattus norvegicus


Alignment Length:389 Identity:98/389 - (25%)
Similarity:153/389 - (39%) Gaps:94/389 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVSHEVSLSDSTTSLELSNCCRLCLEEPYPNQ-MLDMTVIYDQEAALSYYDCYEI--CTKEDLRQ 88
            |.|..||.:|.|.......     .|:..|:| :|.|.|:.:..:.|...:.::.  ..::|.|:
  Rat    87 LASGSVSFTDVTVDFSQEE-----WEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQVEKDPRE 146

  Fly    89 ---------NPKNEPRT------LCKRCAV--------ELKWAYDFHKKMAIANQQLREIFVATE 130
                     .|||:|.|      ..||..:        ::.:.|..:.|..:.|..|.       
  Rat   147 PDKQAPSLTTPKNQPPTEERGSLFGKRLNLNTDLVSLRQVPYKYYLYGKTLMYNSDLL------- 204

  Fly   131 ANTEQEDDVEDEENEADMNEEFLMEEIEEKQETP---------------------------IDSL 168
              :.:...||..:....:.|..|.    .|||.|                           |.||
  Rat   205 --SSRSCVVEKGDECGGLGEPLLY----LKQEKPHAGLQYSEYNGNGRSLSHTDAIFKHQKIKSL 263

  Fly   169 ED----------------IVPRNR-HTGKS--NCKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQ 214
            ..                :|...| |||:.  .|..|.|.|.:.:.:.|||.||...:| |.|.:
  Rat   264 VQPFVCNYCDKAFSFKSLLVSHKRIHTGEKPYECNVCQKTFSHKANLIKHQRIHTGEKP-FECPE 327

  Fly   215 CDRVYLTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRS 279
            |.:.:..:..|.||..:...:....|:.|||.||....|..|:|.|..:.||.|:.|.:.|.::|
  Rat   328 CGKAFTHQSNLIVHQRAHMAKKPYGCNECGKTFAQKFELTTHQRIHTGERPYECNECAKTFFKKS 392

  Fly   280 HLTVHQQVKHSGSRFICEFPGCQKSFTSSSSLRNHECTHTA-MPFECAHCHQSYPARNKLRMHL 342
            :|.:||::.....|:.|.  .|.|||..:|.|..|..|||. .|:||..|.:::..|:.||:||
  Rat   393 NLIIHQKIHTGEKRYECS--ECGKSFIQNSQLIIHRRTHTGEKPYECTECGKTFSQRSTLRLHL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 20/103 (19%)
C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..232 CDD:275368 5/19 (26%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
C2H2 Zn finger 268..289 CDD:275368 7/20 (35%)
C2H2 Zn finger 296..318 CDD:275368 8/21 (38%)
C2H2 Zn finger 325..346 CDD:275368 7/18 (39%)
Zfp1XP_017456932.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.