DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and wdn

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster


Alignment Length:516 Identity:102/516 - (19%)
Similarity:157/516 - (30%) Gaps:176/516 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AEAPVKLVSHEV--------------SLSDSTTSLELSNCCRL------------------CLEE 53
            |..|.|....|:              |:.|.:..::||.|..:                  .|:|
  Fly    29 AGTPTKAAHDEILSSLLRINNFDSISSIKDESLDIDLSACVTISSASLVNGNSLSSTDFWRVLDE 93

  Fly    54 PYPNQM---LDMTVIYDQEAALSYYDCYEICTKED----------LRQNPKN------------- 92
            ...|..   |...|..|..||.|........|.::          ||..|.|             
  Fly    94 SAQNNTELNLSSDVCRDDLAATSSSTVPSTLTSDNHSSSEFSVTFLRPEPPNAFTNSPFKKTSSS 158

  Fly    93 --------EPRTLCKRCAVELKWAYDFHKKMAIANQQLREIFVATEANTEQEDDVEDEENEADMN 149
                    .|..|.::..:::..:....:|..:.......:.|..|...|::...|....:.::.
  Fly   159 GTSTPVKLSPEQLHQQHQLQMPQSQLLQRKPKLPAATAVRLKVFKEEPPEEKHPPEQVVTKVEVC 223

  Fly   150 EEFLM-------------EEIEEKQETPIDSLE-----DIVPRNRHTGKSNCKFCH-KEFRNHSR 195
            |..|:             |.:.:....|..:..     ::.|...|    .|..|: ........
  Fly   224 ESELLPPSFTIFQQAKSAESVADAASMPPPAASETKPLEVDPAPLH----KCLDCNGLLLETPDE 284

  Fly   196 MAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSG----------------------- 237
            :|||:......|..:|||:|.|.:.....||.|:.: ||..|                       
  Fly   285 VAKHEAAAHRLRLTYRCSECQREFELLAGLKKHLKT-HRTEGRKDTWKKCPDCGKCLKLGSMWMH 348

  Fly   238 --VH-------CDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSR 293
              :|       ||.||:.|.....|..|.|.|:.:.||.|..|.:||.:||||..||:.......
  Fly   349 RKIHSDNKKYQCDICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHLQRHQKYHAQTRS 413

  Fly   294 FICEFPG--------------------------CQKSFTSSSSLRNHECTHTAM-PFECAHCHQS 331
            :.||..|                          |.|||.|:|.|:.|...||.| ||:|.:|.:.
  Fly   414 YRCEKCGKMYKTERCLKVHNLVHLEQRPFACTVCDKSFISNSKLKQHSNIHTGMRPFKCNYCPRD 478

  Fly   332 YPARNKLRMHLERKHNMVVQMEDLEEMRKFHIVRSKLVMAKIYSDQKESHHAKNDSAAISK 392
            :........|..|:|.:                           |.|...|.:|..:..||
  Fly   479 FTNFPNWLKHTRRRHKV---------------------------DHKTGEHLENIPSYCSK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 18/129 (14%)
C2H2 Zn finger 183..203 CDD:275368 5/20 (25%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
C2H2 Zn finger 268..289 CDD:275368 10/20 (50%)
C2H2 Zn finger 296..318 CDD:275368 11/47 (23%)
C2H2 Zn finger 325..346 CDD:275368 4/20 (20%)
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 7/20 (35%)
RPB9 333..425 CDD:224510 25/91 (27%)
C2H2 Zn finger 333..352 CDD:275368 0/18 (0%)
zf-H2C2_2 344..369 CDD:290200 6/24 (25%)
zf-C2H2 358..380 CDD:278523 8/21 (38%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
zf-H2C2_2 372..395 CDD:290200 8/22 (36%)
zf-C2H2 386..408 CDD:278523 11/21 (52%)
C2H2 Zn finger 388..436 CDD:275368 13/47 (28%)
zf-H2C2_2 400..425 CDD:290200 7/24 (29%)
C2H2 Zn finger 416..433 CDD:275368 3/16 (19%)
zf-H2C2_2 429..453 CDD:290200 4/23 (17%)
C2H2 Zn finger 444..464 CDD:275368 8/19 (42%)
zf-H2C2_2 457..481 CDD:290200 9/23 (39%)
C2H2 Zn finger 472..493 CDD:275368 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.