DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and sqz

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster


Alignment Length:302 Identity:67/302 - (22%)
Similarity:113/302 - (37%) Gaps:57/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DLRQNPKNEPRTLCKRCAVELKWAYDFHKKMAIANQQLR-------------------EIFVATE 130
            :.|||       :.:|....||.....|::..:..||..                   ::.|:..
  Fly    46 EFRQN-------VAERLDYSLKNGLVQHQQQMVMEQQPHPDQQQQQHLHHPQQQQHPPQLKVSYS 103

  Fly   131 ANTEQEDDVEDEENEADMNEEFLMEEIEEKQETPIDSLEDIVPRNRHTGKS----NCKFCHKEFR 191
            |........|.:|.:.|.|.....:::.....:..:.........|..|..    .|..|.|.|.
  Fly   104 APNSPPTPHEQQEQKYDPNRSPPRQQMSSASGSGSNGSSPEEESRRGDGDQAKPYKCGSCSKSFA 168

  Fly   192 NHSRMAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDS-------KHRQSGVHCDTCGKVFAI 249
            |.|.:::|..|||..:| :||..|.|.:.....|:.|:.:       |.|.:|     |.|.|:.
  Fly   169 NSSYLSQHTRIHLGIKP-YRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAG-----CPKAFSQ 227

  Fly   250 AKALEIHKRYHNRDFPYSCDLCDRRFAQR----SHLTVHQQVKHSGSRFICEFPGCQKSFTSSSS 310
            ...|:.|.|.|..|.|:.|:.|.:.|:..    .|:..|:..||..:. ||..  |.||:|..:.
  Fly   228 LSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTH-ICNL--CGKSYTQETY 289

  Fly   311 LRNHECTHTAMPFECAH-------CHQSYPARNKLRMHLERK 345
            |:.|...|.....:..|       .||.:...:.:.::|:|:
  Fly   290 LQKHLQKHAEKAEKQQHRHTAQVAAHQQHVPASGIGLNLQRQ 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 9/57 (16%)
C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..232 CDD:275368 5/26 (19%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..289 CDD:275368 5/24 (21%)
C2H2 Zn finger 296..318 CDD:275368 7/21 (33%)
C2H2 Zn finger 325..346 CDD:275368 5/28 (18%)
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 7/19 (37%)
zf-H2C2_2 172..197 CDD:290200 9/25 (36%)
zf-C2H2 186..208 CDD:278523 6/21 (29%)
C2H2 Zn finger 188..208 CDD:275368 5/19 (26%)
zf-C2H2_8 191..271 CDD:292531 21/84 (25%)
zf-H2C2_2 200..227 CDD:290200 8/31 (26%)
C2H2 Zn finger 216..238 CDD:275368 8/26 (31%)
C2H2 Zn finger 246..266 CDD:275368 4/19 (21%)
C2H2 Zn finger 277..297 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3043
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.