DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and CG6813

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:364 Identity:86/364 - (23%)
Similarity:133/364 - (36%) Gaps:100/364 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LNFTIARRTAEAPVKLV----SHEVSLSDSTTSLELSNCCRLCLEEPYPNQMLDMTVIYDQEAAL 72
            ||..|..| ::||:.|.    .|.|....|.|.:|||                            
  Fly     4 LNCRICSR-SDAPIDLFGPGNGHLVRQIHSITGVELS---------------------------- 39

  Fly    73 SYYDCYEICTKEDLRQNPKNEPRTLCKRCAVELKWAYDFHKKMAIANQQLREIFVATEANTEQE- 136
                    |.||...|        :|..|...|:.|..|.::..||.:|..|.......:...: 
  Fly    40 --------CKKEISGQ--------MCTTCLDNLQAAIKFRQRCIIAEKQNLERIECDSKDCSTDP 88

  Fly   137 ---DDVEDEENEADMNEEFLMEEIEEKQETPIDSLEDI-VPRNRH--------TGKSNCKFCHKE 189
               :|::|.:.|::::|..|..|:   ::.|:.|.|.: .|.:.:        ||...|..|.:.
  Fly    89 IIYEDIDDNQIESELDESILCPEV---KDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRI 150

  Fly   190 FRNHSRMAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKALE 254
            ..|.|...:|.:.|...: ||.|     |:|                     .|.:.||..|.|.
  Fly   151 INNKSNFQEHTLRHTGIK-NFHC-----VFL---------------------NCERSFATRKELT 188

  Fly   255 IHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSRFICEFPGCQKSFTSSSSLRNHECTHT 319
            .|.|.|..:.||.|..|.|||:.......|.:...:..|:.|:  .|:|||.||..||.|:..|.
  Fly   189 SHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECD--TCKKSFVSSGCLRKHKMIHV 251

  Fly   320 -AMPFECAHCHQSYPARNKLRMHL-----ERKHNMVVQM 352
             |....|..|.:.:...:.|..||     :||...:.::
  Fly   252 DARNHYCYVCQKHFKRISHLMTHLSSNIHKRKEEKLTEL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 12/77 (16%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..232 CDD:275368 3/19 (16%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 296..318 CDD:275368 10/21 (48%)
C2H2 Zn finger 325..346 CDD:275368 6/25 (24%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 24/114 (21%)
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 10/47 (21%)
zf-H2C2_2 186..211 CDD:290200 11/24 (46%)
UFD2 <256..>294 CDD:227443 7/35 (20%)
C2H2 Zn finger 258..280 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.