DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and CG4820

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:401 Identity:80/401 - (19%)
Similarity:129/401 - (32%) Gaps:149/401 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CRLCLEEPYPNQMLDMTVIYDQEAALSYYDCYEICTKEDLR-------------QNPKNEPRTLC 98
            ||.|          ..||:.|        :|.:|.|....:             ||.::.|..:|
  Fly     5 CRTC----------GKTVVAD--------ECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHIC 51

  Fly    99 KRCAVELKWAYDFHKKMA-------------------IANQQLREIFVATEANTEQEDDVEDEEN 144
            ..|.|.|.....|.::.|                   .|.:|||    ..:|.......:::..:
  Fly    52 TDCQVLLSQVQKFRRRCAKIEKYFARRRRRMNLGEAPAAMEQLR----VQQAAAPDPLGIDELMS 112

  Fly   145 EADMNEEFLMEEIEEKQETPIDSL-------------EDIVP----------------------R 174
            .:|:..|.:..::||..:.|....             |||:|                      |
  Fly   113 ASDIKIEPIQLQMEEDPQAPYPENQLEQALSYGNAPGEDILPLPEDYGEAQTEVATTTNEPAQRR 177

  Fly   175 NRHTGKSNCKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVH 239
            :::|.|...|       .|:.....::||:            :|...||..:: ||    ::|..
  Fly   178 SKNTAKIKSK-------KHTMRVGRKLIHV------------KVIDDKQPKRI-VD----RNGPS 218

  Fly   240 -----CDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSRFICEFP 299
                 |:.||:.|.....|.:|...|....|:.||.|.:: ....||....|:||:...:.|.|.
  Fly   219 AKPCICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQK-CYTLHLLRRHQLKHTEGPYACTFC 282

  Fly   300 GCQKSFTSSSSLRNHE---CTHTAMP-------------FECAHCHQSYPARNKLRMHL------ 342
            |.:.| |:||.:| ||   |.....|             |.|..|...:........|:      
  Fly   283 GLEYS-TNSSRVR-HEREACKKGRAPQSKWEIIKKGERTFHCEVCDLWFLRAGNFTQHINSSSHI 345

  Fly   343 ------ERKHN 347
                  :||.|
  Fly   346 ENERRKKRKSN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 21/108 (19%)
C2H2 Zn finger 183..203 CDD:275368 2/19 (11%)
C2H2 Zn finger 212..232 CDD:275368 5/19 (26%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 296..318 CDD:275368 11/24 (46%)
C2H2 Zn finger 325..346 CDD:275368 4/32 (13%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 18/87 (21%)
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 6/20 (30%)
C2H2 Zn finger 279..297 CDD:275368 9/19 (47%)
C2H2 Zn finger 322..339 CDD:275368 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.