DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and Blimp-1

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster


Alignment Length:157 Identity:53/157 - (33%)
Similarity:77/157 - (49%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 PRNRHTGKSN--CKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQCDR-----VYLTKQALKVHVD 230
            |..:..||.:  |..|.|.|...|.:..|...|...|| |:|:.|.:     .:|.|..| ||..
  Fly   880 PLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERP-FKCNVCTKSFTQLAHLQKHHL-VHTG 942

  Fly   231 SKHRQSGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSRFI 295
            .|..|    ||.|.|.|:....|:.|.|.|:...||:||||.::|.|..||.:|:::..:...::
  Fly   943 EKPHQ----CDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYV 1003

  Fly   296 CEFPGCQKSFTSSSSLRNHECTHTAMP 322
            |:  ||.|.:.|:|.||.|..|.:..|
  Fly  1004 CQ--GCDKKYISASGLRTHWKTTSCKP 1028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071
C2H2 Zn finger 183..203 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..232 CDD:275368 7/24 (29%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
C2H2 Zn finger 268..289 CDD:275368 9/20 (45%)
C2H2 Zn finger 296..318 CDD:275368 9/21 (43%)
C2H2 Zn finger 325..346 CDD:275368
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 6/19 (32%)
zf-H2C2_2 904..929 CDD:290200 7/25 (28%)
C2H2 Zn finger 920..940 CDD:275368 5/20 (25%)
zf-H2C2_2 932..957 CDD:290200 12/29 (41%)
C2H2 Zn finger 948..968 CDD:275368 8/19 (42%)
zf-H2C2_2 960..985 CDD:290200 11/24 (46%)
C2H2 Zn finger 976..996 CDD:275368 9/19 (47%)
C2H2 Zn finger 1004..1023 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.