DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and CG1603

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster


Alignment Length:329 Identity:75/329 - (22%)
Similarity:126/329 - (38%) Gaps:68/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 APVKLVSHEVSLSDSTTSLELS----NCCRLCLEEPYPNQMLDMTVIYDQEAALSYYDCYEICTK 83
            ||| :...|....:..|:::|:    |.......|.|.|    ..|:|:|  ||..:...||...
  Fly   290 APV-VTPRENEEDNDLTAIKLNFKEENLITTSFIETYAN----YPVLYNQ--ALPDFGSIEIRAD 347

  Fly    84 EDLRQNPKNEPRTLCKRCAVEL------KWAYDFHKKM-------AIANQQLREI----FVATEA 131
            ...|...:.:|........|.:      :|.||..:::       ..:.|:::.:    |:..:.
  Fly   348 AFKRMAKEFQPVVKANETDVYIAVNKLRRWLYDAIRRLKSKELIQKCSKQEVQYLQMCSFLPAKG 412

  Fly   132 NTEQ--EDDVEDEENEADMNEEFLMEEIEEKQETPIDSLEDIVPRNRHTGKSNCKFCHKEFRNHS 194
            :..|  ..|..|:....|.|....:.:..|..:.|.                .|.||.:.|..|.
  Fly   413 SESQVLYCDYCDKRFHGDYNLRVHIVKAHEVGDLPY----------------LCSFCPRRFDRHV 461

  Fly   195 RMAKHQMIHLANRPNF----RCSQCDRVYLTKQALKVHVDSKHRQSGVH-CDTCGKVFAIAKALE 254
            .|.:|::     |.:|    :|..|::.:.....||||. ..|.....| ||.|||.|.:...|:
  Fly   462 DMDRHKL-----RSHFERKLKCQYCEKSFAVDTDLKVHT-LIHTGERPHVCDICGKTFRLKLLLD 520

  Fly   255 IH-KRYHNRDFPYSCDLCDRRFAQR----SHLTVHQQVKHSGSRFICEFPGCQKSFTSSSSLRNH 314
            .| ...|....||||::|.:.|.::    :|:..|..::...    ||:  |..:|...|||..|
  Fly   521 HHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKK----CEY--CDATFYDHSSLSRH 579

  Fly   315 ECTH 318
            ..:|
  Fly   580 RRSH 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 17/90 (19%)
C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
C2H2 Zn finger 240..260 CDD:275368 8/20 (40%)
C2H2 Zn finger 268..289 CDD:275368 5/24 (21%)
C2H2 Zn finger 296..318 CDD:275368 8/21 (38%)
C2H2 Zn finger 325..346 CDD:275368
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916 17/92 (18%)
C2H2 Zn finger 420..441 CDD:275368 4/20 (20%)
COG5048 <424..583 CDD:227381 47/186 (25%)
C2H2 Zn finger 450..471 CDD:275368 8/25 (32%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
zf-H2C2_2 490..513 CDD:290200 11/23 (48%)
C2H2 Zn finger 506..527 CDD:275368 8/20 (40%)
C2H2 Zn finger 535..555 CDD:275368 4/19 (21%)
C2H2 Zn finger 563..583 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.