DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and ZK686.5

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001023030.2 Gene:ZK686.5 / 3565160 WormBaseID:WBGene00022795 Length:263 Species:Caenorhabditis elegans


Alignment Length:81 Identity:22/81 - (27%)
Similarity:35/81 - (43%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 CSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKALEIHKRYH---NRDFPYSCDLCDR 273
            |..|::.:.:.:.|.:|....|....:.|..|.|:|:.......|.:.|   |......|:||||
 Worm   173 CELCEQNFSSSKMLLLHRGKVHNTPYIECHLCMKLFSQTIQFNRHMKTHYGPNAKIYVQCELCDR 237

  Fly   274 RFAQRSHLTVHQQVKH 289
            :|..:..|..|..|.|
 Worm   238 QFKDKQSLRTHWDVSH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071
C2H2 Zn finger 183..203 CDD:275368
C2H2 Zn finger 212..232 CDD:275368 4/19 (21%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
C2H2 Zn finger 268..289 CDD:275368 9/20 (45%)
C2H2 Zn finger 296..318 CDD:275368
C2H2 Zn finger 325..346 CDD:275368
ZK686.5NP_001023030.2 C2H2 Zn finger 173..194 CDD:275368 4/20 (20%)
C2H2 Zn finger 201..221 CDD:275368 5/19 (26%)
zf-C2H2_8 <204..251 CDD:292531 14/46 (30%)
C2H2 Zn finger 232..248 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.