DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and sna

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster


Alignment Length:146 Identity:46/146 - (31%)
Similarity:66/146 - (45%) Gaps:13/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 CKFCHKEFRNHSRMAKHQMIHL------ANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCD 241
            |..|.|.:.....::||:..|.      ..:....|.:|.::|.|..|||:|:  :.......|.
  Fly   247 CDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHI--RTHTLPCKCP 309

  Fly   242 TCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSRFICEFPGCQKSFT 306
            .|||.|:....|:.|.|.|..:.|:.|..|.|.||.||:|..|||......::.|:.  |.|||:
  Fly   310 ICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQV--CHKSFS 372

  Fly   307 SSSSLRNH---ECTHT 319
            ..|.|..|   .||.|
  Fly   373 RMSLLNKHSSSNCTIT 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
C2H2 Zn finger 268..289 CDD:275368 11/20 (55%)
C2H2 Zn finger 296..318 CDD:275368 9/24 (38%)
C2H2 Zn finger 325..346 CDD:275368
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..344 CDD:290200 8/22 (36%)
zf-C2H2 334..356 CDD:278523 11/21 (52%)
C2H2 Zn finger 336..356 CDD:275368 11/19 (58%)
zf-H2C2_2 348..373 CDD:290200 9/26 (35%)
C2H2 Zn finger 364..380 CDD:275368 7/17 (41%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
C2H2 Zn finger 282..302 CDD:275368 8/21 (38%)
zf-C2H2 306..328 CDD:278523 8/21 (38%)
COG5048 307..>356 CDD:227381 21/48 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.