Sequence 1: | NP_001262965.1 | Gene: | CG4730 / 43099 | FlyBaseID: | FBgn0039355 | Length: | 392 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350854.1 | Gene: | Cf2 / 33692 | FlyBaseID: | FBgn0000286 | Length: | 537 | Species: | Drosophila melanogaster |
Alignment Length: | 301 | Identity: | 65/301 - (21%) |
---|---|---|---|
Similarity: | 100/301 - (33%) | Gaps: | 99/301 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 QEAALSYYDCYEICTKEDLRQNPKNEPRTLCKRCAVELKWAYDFHKKMAIANQQLREIFVATEAN 132
Fly 133 TEQEDDVEDEENEADMNEEFLMEEIEEKQ------------------------------------ 161
Fly 162 ---ETPIDSLED--------------------------------IVPRN-RHTGKSNCKFCHKEF 190
Fly 191 RNHSRMAKHQMIHLA-------NRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKVFA 248
Fly 249 IAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKH 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4730 | NP_001262965.1 | zf-AD | 46..124 | CDD:285071 | 11/55 (20%) |
C2H2 Zn finger | 183..203 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 212..232 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 268..289 | CDD:275368 | 12/20 (60%) | ||
C2H2 Zn finger | 296..318 | CDD:275368 | |||
C2H2 Zn finger | 325..346 | CDD:275368 | |||
Cf2 | NP_001350854.1 | COG5048 | <366..>473 | CDD:227381 | 35/107 (33%) |
C2H2 Zn finger | 368..388 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 403..423 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 431..451 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 443..468 | CDD:316026 | 11/24 (46%) | ||
C2H2 Zn finger | 459..480 | CDD:275368 | 12/20 (60%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45468433 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |