DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4730 and CG42726

DIOPT Version :9

Sequence 1:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:202 Identity:57/202 - (28%)
Similarity:92/202 - (45%) Gaps:21/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 EIEEKQETPIDSLED----IVPRNRHTGKSNCKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQCD 216
            :|:|.|||...:..|    :..:..|     |..|:|:||:.::...|..........|.|.:|.
  Fly    48 DIQETQETQARTSADKRIIVTDKGYH-----CTVCNKDFRSRTQQYYHLTCGNDLLKKFNCKECG 107

  Fly   217 RVYLTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQR--- 278
            |.:.|...||.|:.|..:||...|..|.|.|.....|:.|...||:: .:.|.:|.:.|.::   
  Fly   108 RRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQE-KHLCPICQKVFRRKSSL 171

  Fly   279 -SHLTVHQQVKHSGSRFICEFPGCQKSFTSSSSLRNHECTH--TAMPFECAHCHQSYPARNKLRM 340
             |||.:|..:   |.:|.||.  |.|.|.:.::|..|...|  ..:...|..|.:|:..:..||:
  Fly   172 ASHLAIHSDL---GLQFKCEL--CSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRL 231

  Fly   341 HLERKHN 347
            |::|..|
  Fly   232 HMKRHSN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071
C2H2 Zn finger 183..203 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..289 CDD:275368 7/24 (29%)
C2H2 Zn finger 296..318 CDD:275368 7/21 (33%)
C2H2 Zn finger 325..346 CDD:275368 7/20 (35%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/19 (32%)
C2H2 Zn finger 103..123 CDD:275368 7/19 (37%)
COG5048 <112..288 CDD:227381 40/133 (30%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 27/94 (29%)
C2H2 Zn finger 158..178 CDD:275368 6/19 (32%)
C2H2 Zn finger 187..207 CDD:275368 7/21 (33%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.