DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4730 and let-391

DIOPT Version :9

Sequence 1:	NP_001262965.1	Gene:	CG4730 / 43099	FlyBaseID:	FBgn0039355	Length:	392	Species:	Drosophila melanogaster
Sequence 2:	NP_491744.3	Gene:	let-391 / 182953	WormBaseID:	WBGene00006492	Length:	453	Species:	Caenorhabditis elegans

Alignment Length:	137	Identity:	41/137 - (29%)
Similarity:	60/137 - (43%)	Gaps:	26/137 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   221 TKQALKVH---------VDSKHRQ--------SGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSC 268
            |..|.|.|         .||.:|:        :...|:.||........:..|.|.|..:.||.|
Worm    23 TPDAQKEHEELEEIVKIPDSTYRKKKGNQKLPTVTTCEVCGVALKYPSRIMEHMRTHTGEKPYEC 87

  Fly   269 DLCDRRFAQRSHLTVHQQVKHSGS-RFICEFPGCQKSFTSSSSLRNHECTHTAMPFECAHCHQSY 332
            |:|..||.||:.:..|.:|:|.|. .|:|.| ||.|.|.::|....||.:|..:       .::.
Worm    88 DICGMRFTQRTPMINHFRVQHMGDLPFLCNF-GCGKRFVNNSRRTAHELSHNGL-------KRAG 144

  Fly   333 PARNKLR 339
            |||..|:
Worm   145 PARPYLK 151

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4730	NP_001262965.1	zf-AD	46..124	CDD:285071
		C2H2 Zn finger	183..203	CDD:275368
		C2H2 Zn finger	212..232	CDD:275368	5/19 (26%)
		C2H2 Zn finger	240..260	CDD:275368	5/19 (26%)
		C2H2 Zn finger	268..289	CDD:275368	9/20 (45%)
		C2H2 Zn finger	296..318	CDD:275368	9/21 (43%)
		C2H2 Zn finger	325..346	CDD:275368	4/15 (27%)
let-391	NP_491744.3	C2H2 Zn finger	59..79	CDD:275368	5/19 (26%)
		zf-H2C2_2	73..96	CDD:290200	10/22 (45%)
		C2H2 Zn finger	87..108	CDD:275368	9/20 (45%)
		C2H2 Zn finger	116..137	CDD:275368	9/21 (43%)
		C2H2 Zn finger	270..290	CDD:275368
		zf-H2C2_2	286..304	CDD:290200
		C2H2 Zn finger	298..319	CDD:275368
		C2H2 Zn finger	327..347	CDD:275368
		C2H2 Zn finger	357..377	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000