Sequence 1: | NP_733115.1 | Gene: | Lgr3 / 43098 | FlyBaseID: | FBgn0039354 | Length: | 765 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014998.3 | Gene: | SOG2 / 854535 | SGDID: | S000005880 | Length: | 791 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 204 | Identity: | 49/204 - (24%) |
---|---|---|---|
Similarity: | 92/204 - (45%) | Gaps: | 33/204 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 MVPRNQSLTLNMTCDIVTYPKACQCGQGTILYCGRYAKLRRFPRLSSEVTNLIIIRNNL-TLRDN 173
Fly 174 IFANFTRLQKLTLKYNNISRVPLGSFSGLFHLERLELSHNNVSHLPHGVFLGLHSLQWLFLVNNH 238
Fly 239 LHHLPVEQLRFFR-RLEWLVLSRNRLT-LRNVQLPKIPTLYEVYLDFNRIEYIGEETFSQLDNLH 301
Fly 302 LLDLQHNLI 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lgr3 | NP_733115.1 | LDLa | 32..65 | CDD:238060 | |
LRR_8 | 179..239 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 181..204 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | <196..354 | CDD:238064 | 30/117 (26%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 8/23 (35%) | ||
leucine-rich repeat | 253..275 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 274..334 | CDD:290566 | 7/37 (19%) | ||
leucine-rich repeat | 276..299 | CDD:275380 | 1/22 (5%) | ||
leucine-rich repeat | 300..323 | CDD:275380 | 6/11 (55%) | ||
leucine-rich repeat | 324..347 | CDD:275380 | |||
7tm_1 | 447..704 | CDD:278431 | |||
SOG2 | NP_014998.3 | LRR | 18..>266 | CDD:227223 | 45/187 (24%) |
leucine-rich repeat | 68..90 | CDD:275378 | 7/22 (32%) | ||
leucine-rich repeat | 91..113 | CDD:275378 | 6/22 (27%) | ||
leucine-rich repeat | 114..138 | CDD:275378 | 8/23 (35%) | ||
leucine-rich repeat | 139..163 | CDD:275378 | 7/46 (15%) | ||
SOG2 | 299..781 | CDD:402174 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4149 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |