DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lgr3 and SOG2

DIOPT Version :9

Sequence 1:NP_733115.1 Gene:Lgr3 / 43098 FlyBaseID:FBgn0039354 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_014998.3 Gene:SOG2 / 854535 SGDID:S000005880 Length:791 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:49/204 - (24%)
Similarity:92/204 - (45%) Gaps:33/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 MVPRNQSLTLNMTCDIVTYPKACQCGQGTILYCGRYAKLRRFPRLSSEVTNLIIIRNNL-TLRDN 173
            ||..:...||:...:.:...|.......||:     ::|....:.||..|.|.:|..|: ::.|.
Yeast     1 MVATSSKRTLDPKEEHLPADKTSTNSSNTII-----SELATQEKSSSSGTTLKLIALNIKSISDE 60

  Fly   174 IFANFTRLQKLTLKYNNISRVPLGSFSGLFHLERLELSHNNVSHLPHGVFLGLHSLQWLFLVNNH 238
            .......:::|:|:.|:::.:| .||..|..|:.|:|.:||...:|: :......|:.|.|.:|.
Yeast    61 DVGYIQNVERLSLRKNHLTSLP-ASFKRLSRLQYLDLHNNNFKEIPY-ILTQCPQLEILDLSSNE 123

  Fly   239 LHHLPVEQLRFFR-RLEWLVLSRNRLT-LRNVQLPKIPTLYEVYLDFNRIEYIGEETFSQLDNLH 301
            :..||.|...|:: .:..|.|..|.:| :||:                       ::.::|:.|.
Yeast   124 IEALPDEISSFWQDNIRVLSLKDNNVTSIRNL-----------------------KSITKLNKLS 165

  Fly   302 LLDLQHNLI 310
            :|||:.|.|
Yeast   166 ILDLEDNKI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lgr3NP_733115.1 LDLa 32..65 CDD:238060
LRR_8 179..239 CDD:290566 17/59 (29%)
leucine-rich repeat 181..204 CDD:275380 7/22 (32%)
LRR_RI <196..354 CDD:238064 30/117 (26%)
leucine-rich repeat 205..228 CDD:275380 6/22 (27%)
leucine-rich repeat 229..252 CDD:275380 8/23 (35%)
leucine-rich repeat 253..275 CDD:275380 6/22 (27%)
LRR_8 274..334 CDD:290566 7/37 (19%)
leucine-rich repeat 276..299 CDD:275380 1/22 (5%)
leucine-rich repeat 300..323 CDD:275380 6/11 (55%)
leucine-rich repeat 324..347 CDD:275380
7tm_1 447..704 CDD:278431
SOG2NP_014998.3 LRR 18..>266 CDD:227223 45/187 (24%)
leucine-rich repeat 68..90 CDD:275378 7/22 (32%)
leucine-rich repeat 91..113 CDD:275378 6/22 (27%)
leucine-rich repeat 114..138 CDD:275378 8/23 (35%)
leucine-rich repeat 139..163 CDD:275378 7/46 (15%)
SOG2 299..781 CDD:402174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4149
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.