DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lgr3 and TSHR

DIOPT Version :9

Sequence 1:NP_733115.1 Gene:Lgr3 / 43098 FlyBaseID:FBgn0039354 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_000360.2 Gene:TSHR / 7253 HGNCID:12373 Length:764 Species:Homo sapiens


Alignment Length:750 Identity:166/750 - (22%)
Similarity:270/750 - (36%) Gaps:217/750 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CQCGQ--GTILYCGRYAKLRRFPRLSSEVTNLIIIRNNL-TLRDNIFANFTRLQKLTLKYNNISR 193
            |:|.|  ...:.|   ..::|.|.|......|.:|..:| |:..:.|:|..          ||||
Human    29 CECHQEEDFRVTC---KDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLP----------NISR 80

  Fly   194 VPLGSFSGLFHLERLELSHN--NVSHLPHGVFLGLHSLQWLFLVNNHLHHLPVEQLRFFRRLEWL 256
            :.:.....|..||    ||:  |:|.:.|.......:|  .::..:.|..||:  |:|       
Human    81 IYVSIDVTLQQLE----SHSFYNLSKVTHIEIRNTRNL--TYIDPDALKELPL--LKF------- 130

  Fly   257 VLSRNRLTLRNVQLPKIPTLYEVYLDFNRIEYIGEETFSQLDNLHLLDLQHN-LITHIHGRAFAN 320
                  |.:.|..|...|.|.:||               ..|...:|::..| .:|.|...||..
Human   131 ------LGIFNTGLKMFPDLTKVY---------------STDIFFILEITDNPYMTSIPVNAFQG 174

  Fly   321 LTN-MRDIRLVGNPIKELSGETFLHNTRLEALSL------------ALMPIHISSSLME------ 366
            |.| ...::|..|....:.|..| :.|:|:|:.|            |...::...||::      
Human   175 LCNETLTLKLYNNGFTSVQGYAF-NGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSV 238

  Fly   367 -------------------------PLNISFLNLTGIRYD------------------------- 381
                                     ||::|||:||  |.|                         
Human   239 TALPSKGLEHLKELIARNTWTLKKLPLSLSFLHLT--RADLSYPSHCCAFKNQKKIRGILESLMC 301

  Fly   382 ---------------------HIDFEA---------------INSMRNLTYII------------ 398
                                 |.::|.               .::..|..|.:            
Human   302 NESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQEDEIIGF 366

  Fly   399 ------------------YDRFFYCSMTPRVRMCKPSTDGVSSFQDLLSKPVLRYSAWVMATLTI 445
                              || :..|..:..: :|.|.:|..:..:|::....||...|.::.|.:
Human   367 GQELKNPQEETLQAFDSHYD-YTICGDSEDM-VCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLAL 429

  Fly   446 AGNVLVLWGRFIYRDENVAVTM---VIRNLALADMLMGFYLVTIGVQDYRYRNEYYKVVLDWITS 507
            .|||.||   .|....:..:.:   ::.|||.||..||.||:.|...|....:|||...:||.|.
Human   430 LGNVFVL---LILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQTG 491

  Fly   508 WQCTLIGTLAVSSSEVSMLILAFMSLERFLLIADPFRGHRSIGNRVMWLALICIWITGVGLAVAP 572
            ..|...|...|.:||:|:..|..::|||:..|....|..|.|..|.....::..|:....||:.|
Human   492 PGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACAIMVGGWVCCFLLALLP 556

  Fly   573 VLLWRTSTLPYYGSYSGTCFPLHIHEAFPMGWLYSAFVFLGVNLLLLVMIAMLYTALLISIWRTR 637
            ::     .:..|...| .|.|:....  |:...|..|| |.:|::..|::...|..:.|:: |..
Human   557 LV-----GISSYAKVS-ICLPMDTET--PLALAYIVFV-LTLNIVAFVIVCCCYVKIYITV-RNP 611

  Fly   638 SATPLTLLDCEFAVRFFFIVLTDFLCWVPIIVMKIWVFFN---YNISDDIYAWLVVFVLPLNSAV 699
            ...|.. .|.:.|.|...::.|||:|..||....:....|   ..:|:.  ..|:|...||||..
Human   612 QYNPGD-KDTKIAKRMAVLIFTDFICMAPISFYALSAILNKPLITVSNS--KILLVLFYPLNSCA 673

  Fly   700 NPLLYTFTTPKYRNQIFLRGWKKITSRKRAEAGNG 734
            ||.||...|..::..:|:...|....:::|:|..|
Human   674 NPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRG 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lgr3NP_733115.1 LDLa 32..65 CDD:238060
LRR_8 179..239 CDD:290566 13/61 (21%)
leucine-rich repeat 181..204 CDD:275380 5/22 (23%)
LRR_RI <196..354 CDD:238064 38/173 (22%)
leucine-rich repeat 205..228 CDD:275380 7/24 (29%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
leucine-rich repeat 253..275 CDD:275380 3/21 (14%)
LRR_8 274..334 CDD:290566 15/61 (25%)
leucine-rich repeat 276..299 CDD:275380 3/22 (14%)
leucine-rich repeat 300..323 CDD:275380 7/23 (30%)
leucine-rich repeat 324..347 CDD:275380 4/22 (18%)
7tm_1 447..704 CDD:278431 76/262 (29%)
TSHRNP_000360.2 leucine-rich repeat 54..77 CDD:275380 6/32 (19%)
LRR_5 66..221 CDD:290045 45/201 (22%)
leucine-rich repeat 78..102 CDD:275380 9/27 (33%)
leucine-rich repeat 103..127 CDD:275380 4/25 (16%)
leucine-rich repeat 147..179 CDD:275380 11/46 (24%)
leucine-rich repeat 180..201 CDD:275380 4/21 (19%)
leucine-rich repeat 202..229 CDD:275380 4/26 (15%)
7tm_4 417..609 CDD:304433 59/204 (29%)
7tm_1 431..678 CDD:278431 76/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.