DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lgr3 and LGR6

DIOPT Version :9

Sequence 1:NP_733115.1 Gene:Lgr3 / 43098 FlyBaseID:FBgn0039354 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001017403.1 Gene:LGR6 / 59352 HGNCID:19719 Length:967 Species:Homo sapiens


Alignment Length:765 Identity:174/765 - (22%)
Similarity:278/765 - (36%) Gaps:214/765 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 RLSSEVTNLIIIRN--------NLTLRDNIFA--------NFTRLQKLTLKYNNISRVPLGSFSG 201
            ||.:.:.:|:..|:        :|.|.||...        |...||.:||..|.||.:|..:|..
Human   144 RLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQN 208

  Fly   202 LFHLERLELSHNNVSHLPHGVFLGLHSLQWLFLVNNHLHHLPV--------EQLRFFRR------ 252
            |..|..|.|.:|.:.||....|.|||:|:.|.|..|.|...||        ::|.|...      
Human   209 LTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIP 273

  Fly   253 --------------------------------------------------------LEWLVLSR- 260
                                                                    ||.|.|:| 
Human   274 EKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRA 338

  Fly   261 ----------------NRLTLRNVQLPKIPTLY------EVYLDFNRIEYIGEETFSQLDNLHLL 303
                            ..|.|.:.|:.::|:|:      |:.|..|||..||.:|||||.:|..|
Human   339 GIRLLPSGMCQQLPRLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQAL 403

  Fly   304 DLQHNLITHIHGRAFANLTNMRDIRLVGN-----PIKELSGETFLHNTRLE---ALSLALMPIHI 360
            ||..|.|..||..||:.|.::..:.|..|     |:..|.|   |.:.:|:   |||.|     .
Human   404 DLSWNAIRSIHPEAFSTLHSLVKLDLTDNQLTTLPLAGLGG---LMHLKLKGNLALSQA-----F 460

  Fly   361 SSSLMEPLNI----------------SFLNLTGIRYD----HIDFEAINSMRNLTYII------Y 399
            |......|.|                ||...:| :::    |:|.|. :|.|.|..:.      |
Human   461 SKDSFPKLRILEVPYAYQCCPYGMCASFFKASG-QWEAEDLHLDDEE-SSKRPLGLLARQAENHY 523

  Fly   400 DR---FFYCSMT-----PRVRMCKPSTDGVSSFQDLLSKPVLRYSAWVMATLTIAGNVLVLWGRF 456
            |:   .....|.     |.|: |.|:.......:.|.....:|.:.|.:..|::..|.|||...|
Human   524 DQDLDELQLEMEDSKPHPSVQ-CSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVF 587

  Fly   457 IYRDENV-AVTMVIRNLALADMLMGFYLVTIGVQDYRYRNEYYKVVLDWITSWQCTLIGTLAVSS 520
            ......: .|..|:..:|.|:.|.|.....:...|.....::.:....|.|...|...|.|||..
Human   588 AGGPVPLPPVKFVVGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLG 652

  Fly   521 SEVSMLILAFMSLERFLLIA-------DPFRGHRSIGNRVMWLALICIWITGVGLAVAPVLLWRT 578
            ||.|:|:|...:::..:.::       .|..|....|      .|.|:.:.|:..|: |:     
Human   653 SEASVLLLTLAAVQCSVSVSCVRAYGKSPSLGSVRAG------VLGCLALAGLAAAL-PL----- 705

  Fly   579 STLPYYGSYSGTCFPLHIHEAFPMGWLYSAFVFLGVNLLLLVMIAMLYTALLI--------SIWR 635
            :::..||: |..|.|....|..|....::..:.: :|....:::|..|..|..        ::| 
Human   706 ASVGEYGA-SPLCLPYAPPEGQPAALGFTVALVM-MNSFCFLVVAGAYIKLYCDLPRGDFEAVW- 767

  Fly   636 TRSATPLTLLDCEFAVRFFFIVLTDFLCWVPIIVMKIWVFFN-YNISDDIYAWLVVFVLPLNSAV 699
                      ||.......:::..|.|.:.|:..:....... :.::.:....:::.||||.:.:
Human   768 ----------DCAMVRHVAWLIFADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACL 822

  Fly   700 NPLLYTFTTPKYRNQIFLRGWKKITSRKRAEAG-NGNVATTTTGTATGSS 748
            |||||....|.:|:.:         .|.|..|| :|.:|....|....||
Human   823 NPLLYLLFNPHFRDDL---------RRLRPRAGDSGPLAYAAAGELEKSS 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lgr3NP_733115.1 LDLa 32..65 CDD:238060
LRR_8 179..239 CDD:290566 24/59 (41%)
leucine-rich repeat 181..204 CDD:275380 10/22 (45%)
LRR_RI <196..354 CDD:238064 64/258 (25%)
leucine-rich repeat 205..228 CDD:275380 9/22 (41%)
leucine-rich repeat 229..252 CDD:275380 9/30 (30%)
leucine-rich repeat 253..275 CDD:275380 8/38 (21%)
LRR_8 274..334 CDD:290566 27/70 (39%)
leucine-rich repeat 276..299 CDD:275380 13/28 (46%)
leucine-rich repeat 300..323 CDD:275380 11/22 (50%)
leucine-rich repeat 324..347 CDD:275380 6/27 (22%)
7tm_1 447..704 CDD:278431 56/273 (21%)
LGR6NP_001017403.1 LRRNT 34..68 CDD:214470
LRR_RI <57..199 CDD:238064 14/54 (26%)
leucine-rich repeat 70..91 CDD:275380
LRR 1 91..112
LRR_8 92..150 CDD:290566 2/5 (40%)
leucine-rich repeat 92..115 CDD:275380
LRR 2 115..136
leucine-rich repeat 116..139 CDD:275380
LRR_RI 131..392 CDD:238064 55/247 (22%)
LRR 3 139..160 4/15 (27%)
leucine-rich repeat 140..163 CDD:275380 4/18 (22%)
LRR 4 163..186 5/22 (23%)
leucine-rich repeat 164..187 CDD:275380 5/22 (23%)
LRR_8 186..246 CDD:290566 24/59 (41%)
LRR 5 187..208 9/20 (45%)
leucine-rich repeat 188..211 CDD:275380 10/22 (45%)
LRR 6 211..232 7/20 (35%)
leucine-rich repeat 212..235 CDD:275380 9/22 (41%)
LRR 7 235..256 7/20 (35%)
leucine-rich repeat 236..258 CDD:275380 7/21 (33%)
LRR_8 258..314 CDD:290566 2/55 (4%)
LRR 8 258..279 2/20 (10%)
leucine-rich repeat 259..282 CDD:275380 2/22 (9%)
LRR 9 282..303 0/20 (0%)
leucine-rich repeat 283..304 CDD:275380 0/20 (0%)
LRR 10 306..328 0/21 (0%)
LRR 11 329..350 5/20 (25%)
leucine-rich repeat 330..344 CDD:275378 5/13 (38%)
LRR 12 353..374 5/20 (25%)
leucine-rich repeat 354..399 CDD:275380 17/44 (39%)
LRR_8 375..434 CDD:290566 25/58 (43%)
LRR 13 375..396 9/20 (45%)
leucine-rich repeat 376..390 CDD:275378 5/13 (38%)
LRR 14 399..420 10/20 (50%)
leucine-rich repeat 400..423 CDD:275380 11/22 (50%)
LRR 15 423..443 3/19 (16%)
leucine-rich repeat 424..444 CDD:275380 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.