Sequence 1: | NP_733115.1 | Gene: | Lgr3 / 43098 | FlyBaseID: | FBgn0039354 | Length: | 765 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002627.1 | Gene: | lrrc57 / 436900 | ZFINID: | ZDB-GENE-040718-372 | Length: | 238 | Species: | Danio rerio |
Alignment Length: | 242 | Identity: | 66/242 - (27%) |
---|---|---|---|
Similarity: | 103/242 - (42%) | Gaps: | 68/242 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 181 LQKLT-------LKYNNISRVP--LGSFSGLFHLERLELSHNNVSHLPHGVFLG-LHSLQWLFLV 235
Fly 236 NNHLHHLP--VEQLRFFRRLEWLVLSRNRLTLRNVQLPKIPTLYEVYLDFNRIEYIGEETFSQLD 298
Fly 299 NLHLLDLQHNLITHIHGRAFANLTNMRDIRL------VGNPIKELSGETFLHNTRLE--ALSLAL 355
Fly 356 MPIHISSSLMEPLNISFLNLTGIRYDHIDFEAINSMRNLTYIIYDRF 402 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lgr3 | NP_733115.1 | LDLa | 32..65 | CDD:238060 | |
LRR_8 | 179..239 | CDD:290566 | 24/67 (36%) | ||
leucine-rich repeat | 181..204 | CDD:275380 | 12/31 (39%) | ||
LRR_RI | <196..354 | CDD:238064 | 46/168 (27%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 253..275 | CDD:275380 | 5/21 (24%) | ||
LRR_8 | 274..334 | CDD:290566 | 13/65 (20%) | ||
leucine-rich repeat | 276..299 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 300..323 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 324..347 | CDD:275380 | 4/28 (14%) | ||
7tm_1 | 447..704 | CDD:278431 | |||
lrrc57 | NP_001002627.1 | LRR 1 | 10..36 | 2/2 (100%) | |
LRR_RI | <37..191 | CDD:238064 | 52/189 (28%) | ||
LRR 2 | 37..62 | 8/27 (30%) | |||
leucine-rich repeat | 40..65 | CDD:275380 | 9/27 (33%) | ||
LRR_8 | 62..119 | CDD:290566 | 22/68 (32%) | ||
LRR 3 | 64..82 | 4/19 (21%) | |||
leucine-rich repeat | 66..85 | CDD:275380 | 6/20 (30%) | ||
LRR 4 | 83..106 | 8/22 (36%) | |||
leucine-rich repeat | 86..108 | CDD:275380 | 9/21 (43%) | ||
LRR 5 | 108..128 | 8/43 (19%) | |||
leucine-rich repeat | 109..131 | CDD:275380 | 9/45 (20%) | ||
LRR 6 | 129..152 | 9/29 (31%) | |||
leucine-rich repeat | 132..154 | CDD:275380 | 8/28 (29%) | ||
LRR 7 | 154..173 | 2/18 (11%) | |||
leucine-rich repeat | 155..176 | CDD:275380 | 3/20 (15%) | ||
LRR 8 | 174..199 | 8/28 (29%) | |||
leucine-rich repeat | 177..198 | CDD:275380 | 8/24 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4149 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |