DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lgr3 and LHCGR

DIOPT Version :9

Sequence 1:NP_733115.1 Gene:Lgr3 / 43098 FlyBaseID:FBgn0039354 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_000224.2 Gene:LHCGR / 3973 HGNCID:6585 Length:699 Species:Homo sapiens


Alignment Length:683 Identity:152/683 - (22%)
Similarity:256/683 - (37%) Gaps:162/683 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LQKLTLKYNNISRVPLGSFSGLFHLERLELSH-NNVSHLPHGVFLGLHSLQWLFLVNNHLHHLPV 244
            |.:|:|.|..:..:|..:|.||..:.::|:|. :::..:....|..|.:|..:.:.|       .
Human    51 LTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQN-------T 108

  Fly   245 EQLRFFRRLEWLVLSRNR-LTLRNVQLPKIPTLYEVYLDFNRIEYIGEETF--SQLDNLHLLDLQ 306
            :.||:.....::.|.|.: |::.|..:.|.|.:.:|        :..|..|  ...||||     
Human   109 KNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKV--------FSSESNFILEICDNLH----- 160

  Fly   307 HNLITHIHGRAFANLTNMR-DIRLVGNPIKELSGETF------------------LHN------- 345
               ||.|.|.||..:.|.. .::|.||..:|:....|                  :||       
Human   161 ---ITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGAT 222

  Fly   346 ---------TRLEAL------SLALMPIHISSSLME-PLNISFLNLTGIRYDHIDFEAI------ 388
                     |:|:||      |:..:....|.||.: |...:|:||         .||.      
Human   223 GPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNL---------LEATLTYPSH 278

  Fly   389 --------NSMRNLTYIIYDRF---------------FYCSM----------------TPRVRMC 414
                    ...:|.::.|.:.|               .|.||                .|:...|
Human   279 CCAFRNLPTKEQNFSHSISENFSKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRC 343

  Fly   415 KPSTDGVSSFQDLLSKPVLRYSAWVMATLTIAGNVLVLWGRFIYRDENVAVTMVIRNLALADMLM 479
            .|..|..:..:|::....||...|::..|.|.||:.||:.....|.:......::.||:.||..|
Human   344 APEPDAFNPCEDIMGYDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCM 408

  Fly   480 GFYLVTIGVQDYRYRNEYYKVVLDWITSWQCTLIGTLAVSSSEVSMLILAFMSLERFLLIADPFR 544
            |.||:.|...|.:.:.:||...:||.|...|:..|...|.:||:|:..|..::|||:..|.....
Human   409 GLYLLLIASVDSQTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIH 473

  Fly   545 GHRSIGNRVMWLALICIWITGVGLAVAPVLLWRTSTLPYYGSYSGTCFPLHIHEAFPMGWLYSAF 609
            ..:.:..|...|.::..|:....:|:.|::     .:..|...| .|||:.:.......::.:..
Human   474 LDQKLRLRHAILIMLGGWLFSSLIAMLPLV-----GVSNYMKVS-ICFPMDVETTLSQVYILTIL 532

  Fly   610 VFLGVNLLLLVMIAMLYTALLISIWRTRSATPLTLLDCEFAVRFFFIVLTDFLCWVPIIVMKIWV 674
            :   :|::...:|...|..:..::  .......|..|.:.|.:...::.|||.|..||....|..
Human   533 I---LNVVAFFIICACYIKIYFAV--RNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISA 592

  Fly   675 FF--------NYNISDDIYAWLVVFVLPLNSAVNPLLYTFTTPKYRNQIFLRGWKKITSRKRAE- 730
            .|        |..:       |:|...|:||..||.||...|..::...||...|....::||| 
Human   593 AFKVPLITVTNSKV-------LLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAEL 650

  Fly   731 -------AGNGNVATTTTGTATGSSQHPDDFTI 756
                   |...|.....||     |..|...|:
Human   651 YRRKDFSAYTSNCKNGFTG-----SNKPSQSTL 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lgr3NP_733115.1 LDLa 32..65 CDD:238060
LRR_8 179..239 CDD:290566 14/58 (24%)
leucine-rich repeat 181..204 CDD:275380 8/22 (36%)
LRR_RI <196..354 CDD:238064 43/202 (21%)
leucine-rich repeat 205..228 CDD:275380 4/23 (17%)
leucine-rich repeat 229..252 CDD:275380 4/22 (18%)
leucine-rich repeat 253..275 CDD:275380 5/22 (23%)
LRR_8 274..334 CDD:290566 18/62 (29%)
leucine-rich repeat 276..299 CDD:275380 3/24 (13%)
leucine-rich repeat 300..323 CDD:275380 8/22 (36%)
leucine-rich repeat 324..347 CDD:275380 7/57 (12%)
7tm_1 447..704 CDD:278431 63/264 (24%)
LHCGRNP_000224.2 leucine-rich repeat 51..74 CDD:275380 8/22 (36%)
LRR_5 62..198 CDD:290045 37/158 (23%)
leucine-rich repeat 75..99 CDD:275380 4/23 (17%)
LRR 1 96..115 5/25 (20%)
leucine-rich repeat 100..124 CDD:275380 5/30 (17%)
LRR 2 124..145 6/28 (21%)
leucine-rich repeat 125..150 CDD:275380 6/32 (19%)
LRR 3 149..171 11/29 (38%)
leucine-rich repeat 151..174 CDD:275380 11/30 (37%)
leucine-rich repeat 175..198 CDD:275380 5/22 (23%)
LRR 4 175..196 5/20 (25%)
LRR 5 198..220 2/21 (10%)
leucine-rich repeat 199..223 CDD:275380 2/23 (9%)
LRR 6 223..244 4/20 (20%)
leucine-rich repeat 224..244 CDD:275380 4/19 (21%)
7tm_1 376..623 CDD:278431 63/264 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.