DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lgr3 and Fshr

DIOPT Version :9

Sequence 1:NP_733115.1 Gene:Lgr3 / 43098 FlyBaseID:FBgn0039354 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_038551.3 Gene:Fshr / 14309 MGIID:95583 Length:692 Species:Mus musculus


Alignment Length:693 Identity:177/693 - (25%)
Similarity:264/693 - (38%) Gaps:184/693 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CQCGQGTILYCGRYAKLRRFPRLSSEVTNL--IIIRNNLTLRDNIFANFTRLQKLTLKYNNISRV 194
            |.|..            |.|....|:||.:  .:.||.:.||      |. |.||.:       :
Mouse    23 CHCSN------------RVFLCQDSKVTEIPPDLPRNAIELR------FV-LTKLRV-------I 61

  Fly   195 PLGSFSGLFHLERLELSHNNV---------SHLP--HGV---------------FLGLHSLQWLF 233
            |.|||||...||::|:|.|:|         |:||  |.:               |..|.||::|.
Mouse    62 PKGSFSGFGDLEKIEISQNDVLEVIEADVFSNLPNLHEIRIEKANNLLYINPEAFQNLPSLRYLL 126

  Fly   234 LVNNHLHHLPVEQLRFFRRLEWLVLSRNRLTLRNVQLPKIPTLYEVYLDFN---RIEYIGEETFS 295
            :.|..:.|||.                         ..||.:|.:|.||..   .|..|...:|.
Mouse   127 ISNTGIKHLPA-------------------------FHKIQSLQKVLLDIQDNINIHIIARNSFM 166

  Fly   296 QLD-NLHLLDLQHNLITHIHGRAFANLTNMRDIRLV-GNPIKELSGETF---------------- 342
            .|. ...:|.|..|.|..||..|| |.|.:.::.|. .|.::||..:.|                
Mouse   167 GLSFESVILWLNKNGIQEIHNCAF-NGTQLDELNLSDNNNLEELPDDVFQGASGPVVLDISRTKV 230

  Fly   343 --LHNTRLEAL---------------SLALMPIHISSSLMEPLN-ISFLN-------LTGIRYDH 382
              |.|..||.|               ||....:.|.:||..|.: .:|.|       |..|....
Mouse   231 YSLPNHGLENLKKLRARSTYRLKKLPSLDKFVMLIEASLTYPSHCCAFANWRRQTSELHPICNKS 295

  Fly   383 IDFEAINSMR------------NLTY-----IIYDRFFY--CSMTPRVRMCKPSTDGVSSFQDLL 428
            |..:.|:.|.            ..:|     ::|..|.|  |:....| .|.|..|..:..:|::
Mouse   296 ISRQDIDDMTQPGDQRVSLVDDEPSYGKGSDMLYSEFDYDLCNEFVDV-TCSPKPDAFNPCEDIM 359

  Fly   429 SKPVLRYSAWVMATLTIAGNVLVLWGRFIYRDENVAVTM---VIRNLALADMLMGFYLVTIGVQD 490
            ...:||...|.::.|.|.||..||   .:.......:|:   ::.|||.||:.:|.||:.|...|
Mouse   360 GYNILRVLIWFISILAITGNTTVL---VVLTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVD 421

  Fly   491 YRYRNEYYKVVLDWITSWQCTLIGTLAVSSSEVSMLILAFMSLERFLLIADPFRGHRSIGNRVMW 555
            ...:::|:...:||.|...|...|...|.:||:|:..||.::|||:..|....:    :..:|..
Mouse   422 IHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLAAITLERWHTITHAMQ----LECKVQL 482

  Fly   556 LALICIWITGVGLAVAPVLLWRTSTLPYYG--SYS--GTCFPLHIHEAFPMGWLYSAFVFLGVNL 616
            .....|.:.|...|.|..|      .|.:|  ||.  ..|.|:.|..  |:..|| ....|.:|.
Mouse   483 CHAASIMVLGWAFAFAAAL------FPIFGISSYMKVSICLPMDIDS--PLSQLY-VMALLVLNA 538

  Fly   617 LLLVMIAMLYTALLISIWRTRSATPLTLLDCEFAVRFFFIVLTDFLCWVPIIVMKIWVFFNYNIS 681
            |..|:|...||.:.:::......:  :..|.:.|.|...::.|||||..||:      ||..:.|
Mouse   539 LAFVVICGCYTHIYLTVRNPNIVS--SSRDTKIAKRMATLIFTDFLCMAPIL------FFAISAS 595

  Fly   682 DDI-------YAWLVVFVLPLNSAVNPLLYTFTTPKYRNQIFL 717
            ..:       ...|:|...|:||..||.||...|..:|...|:
Mouse   596 LKVPLITVSKAKILLVLFYPINSCANPFLYAIFTKNFRRDFFV 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lgr3NP_733115.1 LDLa 32..65 CDD:238060
LRR_8 179..239 CDD:290566 25/85 (29%)
leucine-rich repeat 181..204 CDD:275380 9/22 (41%)
LRR_RI <196..354 CDD:238064 55/221 (25%)
leucine-rich repeat 205..228 CDD:275380 12/48 (25%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
leucine-rich repeat 253..275 CDD:275380 2/21 (10%)
LRR_8 274..334 CDD:290566 20/64 (31%)
leucine-rich repeat 276..299 CDD:275380 8/26 (31%)
leucine-rich repeat 300..323 CDD:275380 9/22 (41%)
leucine-rich repeat 324..347 CDD:275380 7/41 (17%)
7tm_1 447..704 CDD:278431 74/270 (27%)
FshrNP_038551.3 LRRNT 17..45 CDD:279764 7/33 (21%)
leucine-rich repeat 48..71 CDD:275380 12/36 (33%)
LRR 1 49..72 12/36 (33%)
LRR_8 72..132 CDD:290566 16/59 (27%)
leucine-rich repeat 72..96 CDD:275380 8/23 (35%)
LRR 2 73..97 8/23 (35%)
leucine-rich repeat 97..121 CDD:275380 3/23 (13%)
LRR 3 98..118 2/19 (11%)
LRR 4 119..143 10/48 (21%)
leucine-rich repeat 122..143 CDD:275380 8/45 (18%)
leucine-rich repeat 144..172 CDD:275380 8/27 (30%)
LRR 5 144..169 7/24 (29%)
LRR 6 170..192 8/22 (36%)
leucine-rich repeat 173..194 CDD:275380 9/21 (43%)
LRR_8 193..245 CDD:290566 11/51 (22%)
LRR 7 193..216 6/22 (27%)
leucine-rich repeat 195..219 CDD:275380 5/23 (22%)
LRR 8 217..240 3/22 (14%)
leucine-rich repeat 220..243 CDD:275380 5/22 (23%)
LRR 9 241..259 2/17 (12%)
GnHR_trans 282..348 CDD:289164 12/66 (18%)
7tm_1 378..625 CDD:278431 74/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.