DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RASSF8 and Rassf9

DIOPT Version :9

Sequence 1:NP_651411.1 Gene:RASSF8 / 43096 FlyBaseID:FBgn0261986 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_075248.1 Gene:Rassf9 / 65053 RGDID:621329 Length:435 Species:Rattus norvegicus


Alignment Length:468 Identity:105/468 - (22%)
Similarity:163/468 - (34%) Gaps:159/468 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ELKVWVEGIQRIVCGVTVNTTCQDVVFALA---HAT--------GKVGRFTLIERWRNNERHLAP 55
            |:.|||...::||||:|..||..||:.||.   .||        ||...:.::|:||.:||.|.|
  Rat    28 EIVVWVCQEEKIVCGLTKRTTSIDVIQALLEEHEATFGEKRFLLGKASDYCIVEKWRGSERALPP 92

  Fly    56 NENPMKLLLKWGEYANDVQFILQRSEN--KTQQQQQQQQQQQQNNNNNNNYAVMTTTKKP--LGP 116
            ....:||...||:...::||:|.:::.  .....:..:.:..|||            :||  |.|
  Rat    93 LTRILKLWKAWGDEQPNMQFVLVKTDAFLPVPLWRTAETKLVQNN------------EKPWELSP 145

  Fly   117 NNNNNNKPAPTLLKQKSNVELSYR-TKELKKSFGGHDAKQFDNIG-IVKGIPQQ-----QQLQSQ 174
            .|.....|..   |||..|..::| ..::::..|.||.   ||:. :|..|..|     ||:|..
  Rat   146 ANYMKTLPPD---KQKRIVRKTFRKLAKIRQDTGSHDR---DNMECLVHLIISQDHTIHQQVQRM 204

  Fly   175 ---------------------------QTAMGAPASPPQEQ---LTPQDNNNVAPL-----VPKH 204
                                       |.|...|.|..:||   ...:||..:..|     |.:.
  Rat   205 KELDMEIEKCEAKIHLDRIGNDGADYVQEAYLMPRSSEEEQKLDFQSEDNQTLEDLNDGEGVSQL 269

  Fly   205 EK----------SLSNPLDMTSTGSNPPAPTNGYNDF-------------------YNNNSSSNQ 240
            |:          .||..::....|    |.|:|..|.                   ...:..:..
  Rat   270 EEQLQYYRALIDKLSAEIEREVKG----AGTDGSEDMEGAAACELENSDLESVKCDLEKSMKAGL 330

  Fly   241 HIYSQLSKSSNELRRSSPNEMYYNNNNNIVNNNNNSPEL----YKQTPTISANGALVPPPYRDPP 301
            .|:|.||....|::.|          ::::.......||    :......|.:|           
  Rat   331 KIHSHLSGIQREIKYS----------DSLLQMKAREYELLAKEFSSLHISSKDG----------- 374

  Fly   302 PPRNSPMCQGQRLASSNADTMSNASSS-------TNPFLSDYDQHSSHNTNSINNNSQAMEEGEP 359
                   |||:    .|....:.||||       |....:.|...:..:|...:|:||..|    
  Rat   375 -------CQGK----ENRGKEAEASSSNGEIPPLTQRVFNTYTNDTDSDTGISSNHSQDSE---- 424

  Fly   360 MFQTTQYNDLLQL 372
                |...|:|.|
  Rat   425 ----TTLGDVLLL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RASSF8NP_651411.1 UBQ 1..81 CDD:294102 33/89 (37%)
Rassf9NP_075248.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
RA 23..118 CDD:214612 33/89 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..423 16/73 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.