DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RASSF8 and rassf9

DIOPT Version :9

Sequence 1:NP_651411.1 Gene:RASSF8 / 43096 FlyBaseID:FBgn0261986 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_031754759.1 Gene:rassf9 / 100485779 XenbaseID:XB-GENE-5825099 Length:429 Species:Xenopus tropicalis


Alignment Length:424 Identity:76/424 - (17%)
Similarity:161/424 - (37%) Gaps:90/424 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ELKVWVEGIQRIVCGVTVNTTCQDVVFAL-----------AHATGKVGRFTLIERWRNNERHLAP 55
            ::.:|....:::|.|:|.:|||.:||.||           ....|:...:.::|:||..||.|..
 Frog    28 QIVIWAGQEEKVVLGLTKHTTCAEVVQALLEDHDMKAGSNTFLLGQPSEYFIVEKWRGFERVLPT 92

  Fly    56 NENPMKLLLKWGEYANDVQFILQRSEN-------KTQQQQQQQQQQQQNNNNNNNYAV------- 106
            ....:||...||:..:::.|:|.:::.       |:.:.:......::::..::.|.:       
 Frog    93 PTKILKLWKAWGKEQSNLNFVLVKADAFLPIPMWKSAEAKISHNVDRKHHQYSSAYHIKALPLDK 157

  Fly   107 -----------MTTTKKPLGPNNNNNNKP-APTLLKQKSNVELS-YRTKELKKSFGGHDAK---- 154
                       :...||.:...:.||.:. ...::.|:..::.. .||:||.|.....:||    
 Frog   158 RKRIIRKAFRKLANLKKDIDFQDRNNLETLIHVIMSQEHTIKQQIQRTEELSKDIESKEAKLHLA 222

  Fly   155 QFDNIG--IVKGIPQQQQLQSQQTAMGAPASPPQEQLTPQDNNNVAPLVPKHEK---------SL 208
            :.:|||  .|:.:..:...:|.:|....|.....|:...|::     |....||         :|
 Frog   223 RVENIGKDYVQNLYLKPVSESTETCKKQPKKYFVEEKRRQED-----LFHLEEKVSHLQALIGNL 282

  Fly   209 SNPLDMTSTGSNPPAPTNGYNDFYNNNSSSNQHIYSQLSKSSNELRRSSPNEMYYNN-------- 265
            |..:: ....|.....:.....|.|:.....::   .||....||..|..:.:..:|        
 Frog   283 STEIE-AEISSIYLRQSKDQESFDNSEKELEEY---DLSNVKQELDESLQHGLQLHNLFDCIQEQ 343

  Fly   266 ----NNNIVNNNNNSPELYKQTPTISANGALVPPPYRDPPPPRNSPM-CQGQRLASSNADTMSNA 325
                ::.::........|.::..::..:..             |.|: ||.|..|::.....::|
 Frog   344 IRCKDSILLKQEQEYKRLEEELQSLCISNT-------------NIPLNCQTQFPANNCVVNKTDA 395

  Fly   326 SSSTNPFLSDYDQHSSHNTNSINNNSQAMEEGEP 359
            :......|.:.|.|.:.:...|  :|...::.||
 Frog   396 TGDLTTILCNMDVHETDSDTGI--SSGISQDSEP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RASSF8NP_651411.1 UBQ 1..81 CDD:294102 24/89 (27%)
rassf9XP_031754759.1 Ubiquitin_like_fold 28..120 CDD:421700 24/91 (26%)
Smc <181..>368 CDD:224117 34/195 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.